Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C3P644

Protein Details
Accession A0A5C3P644    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
21-57RSPSPDDHTRKRYRSRPRSPRRRSPSPRRHQSPSRSNBasic
NLS Segment(s)
PositionSequence
29-82TRKRYRSRPRSPRRRSPSPRRHQSPSRSNLGSGKEDRNNPSERRRGRSTSRSRS
Subcellular Location(s) nucl 26.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MDMDRPRDYGHSRGDDCRRSRSPSPDDHTRKRYRSRPRSPRRRSPSPRRHQSPSRSNLGSGKEDRNNPSERRRGRSTSRSRSRDDDRSRSDGSIRRDGLGLDPSLPPLRPRIPPTACGIQEDV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.6
3 0.6
4 0.62
5 0.59
6 0.59
7 0.62
8 0.63
9 0.61
10 0.62
11 0.66
12 0.68
13 0.72
14 0.73
15 0.77
16 0.76
17 0.77
18 0.77
19 0.79
20 0.8
21 0.82
22 0.84
23 0.85
24 0.88
25 0.91
26 0.92
27 0.93
28 0.91
29 0.91
30 0.9
31 0.9
32 0.9
33 0.9
34 0.91
35 0.86
36 0.85
37 0.82
38 0.81
39 0.8
40 0.74
41 0.69
42 0.59
43 0.54
44 0.5
45 0.45
46 0.39
47 0.32
48 0.31
49 0.28
50 0.31
51 0.32
52 0.33
53 0.34
54 0.34
55 0.39
56 0.43
57 0.44
58 0.47
59 0.51
60 0.52
61 0.56
62 0.62
63 0.66
64 0.68
65 0.74
66 0.72
67 0.7
68 0.71
69 0.7
70 0.7
71 0.68
72 0.66
73 0.62
74 0.63
75 0.61
76 0.55
77 0.53
78 0.49
79 0.47
80 0.46
81 0.41
82 0.36
83 0.34
84 0.34
85 0.31
86 0.28
87 0.23
88 0.16
89 0.15
90 0.17
91 0.19
92 0.19
93 0.17
94 0.2
95 0.25
96 0.29
97 0.34
98 0.41
99 0.43
100 0.46
101 0.52
102 0.55
103 0.51