Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3PVX7

Protein Details
Accession A0A5C3PVX7    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
7-43QYRCCSAGRLTRRRVNHKYRWRRFRPYRVFRKFRNGSHydrophilic
NLS Segment(s)
PositionSequence
19-32RRVNHKYRWRRFRP
Subcellular Location(s) mito 17, nucl 7.5, cyto_nucl 5.5
Family & Domain DBs
Amino Acid Sequences MATSRGQYRCCSAGRLTRRRVNHKYRWRRFRPYRVFRKFRNGSAMLILKMPIGTPLGTFNSDCTRSSLSETSEASTATSCVYPGISAALTIAQGSSVSAESNKLTRSDISAGT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.56
3 0.6
4 0.62
5 0.69
6 0.75
7 0.8
8 0.81
9 0.81
10 0.82
11 0.85
12 0.88
13 0.91
14 0.89
15 0.9
16 0.9
17 0.91
18 0.91
19 0.9
20 0.91
21 0.9
22 0.89
23 0.82
24 0.83
25 0.76
26 0.68
27 0.66
28 0.56
29 0.46
30 0.44
31 0.41
32 0.3
33 0.26
34 0.23
35 0.14
36 0.13
37 0.11
38 0.07
39 0.06
40 0.05
41 0.05
42 0.07
43 0.08
44 0.09
45 0.09
46 0.1
47 0.12
48 0.14
49 0.14
50 0.15
51 0.16
52 0.16
53 0.19
54 0.2
55 0.18
56 0.2
57 0.2
58 0.19
59 0.17
60 0.16
61 0.13
62 0.12
63 0.1
64 0.08
65 0.07
66 0.06
67 0.06
68 0.06
69 0.05
70 0.05
71 0.07
72 0.06
73 0.05
74 0.06
75 0.06
76 0.06
77 0.06
78 0.05
79 0.04
80 0.04
81 0.04
82 0.05
83 0.05
84 0.06
85 0.07
86 0.09
87 0.1
88 0.13
89 0.15
90 0.15
91 0.17
92 0.17
93 0.22