Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C3NYD5

Protein Details
Accession A0A5C3NYD5    Localization Confidence Low Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MWSWCTRVRGARRAQRARRRCPSARTHydrophilic
66-85STGISQRRWRGRVRERSRETHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22, nucl 4
Family & Domain DBs
Amino Acid Sequences MWSWCTRVRGARRAQRARRRCPSARTLRSLDVRLDAFSRRAVTASFWMRVRCGMGICGAEVLSYGSTGISQRRWRGRVRERSRET
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.85
3 0.86
4 0.88
5 0.88
6 0.87
7 0.83
8 0.79
9 0.79
10 0.8
11 0.77
12 0.73
13 0.67
14 0.64
15 0.62
16 0.56
17 0.47
18 0.39
19 0.32
20 0.26
21 0.23
22 0.18
23 0.15
24 0.14
25 0.14
26 0.12
27 0.11
28 0.11
29 0.11
30 0.15
31 0.16
32 0.17
33 0.18
34 0.18
35 0.18
36 0.18
37 0.18
38 0.14
39 0.12
40 0.1
41 0.1
42 0.1
43 0.1
44 0.1
45 0.08
46 0.07
47 0.07
48 0.07
49 0.05
50 0.05
51 0.05
52 0.04
53 0.05
54 0.07
55 0.1
56 0.16
57 0.22
58 0.3
59 0.39
60 0.43
61 0.51
62 0.6
63 0.68
64 0.73
65 0.77