Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3PG40

Protein Details
Accession A0A5C3PG40    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
20-50VNHAWETRSRNNRCRSRPFRRPRPPPAPFHYHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, nucl 10, cyto 5
Family & Domain DBs
Amino Acid Sequences MRDHSAQVPVRYSAKSKLSVNHAWETRSRNNRCRSRPFRRPRPPPAPFHYRDPSCAYLMGPLSALSVSNHHHHRLASLVVGLGALGARRIAGRVAQRTPRESGPTLAWRRSARARSGTGLATV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.37
3 0.37
4 0.39
5 0.44
6 0.48
7 0.5
8 0.5
9 0.47
10 0.44
11 0.45
12 0.47
13 0.48
14 0.53
15 0.55
16 0.56
17 0.65
18 0.72
19 0.76
20 0.8
21 0.81
22 0.81
23 0.85
24 0.87
25 0.88
26 0.89
27 0.91
28 0.9
29 0.9
30 0.86
31 0.83
32 0.79
33 0.77
34 0.69
35 0.67
36 0.64
37 0.54
38 0.51
39 0.48
40 0.43
41 0.35
42 0.32
43 0.25
44 0.19
45 0.18
46 0.15
47 0.1
48 0.07
49 0.07
50 0.06
51 0.07
52 0.05
53 0.06
54 0.08
55 0.12
56 0.14
57 0.15
58 0.17
59 0.17
60 0.17
61 0.17
62 0.16
63 0.12
64 0.1
65 0.09
66 0.07
67 0.07
68 0.06
69 0.04
70 0.04
71 0.03
72 0.03
73 0.03
74 0.03
75 0.03
76 0.04
77 0.05
78 0.09
79 0.15
80 0.21
81 0.27
82 0.35
83 0.38
84 0.41
85 0.45
86 0.44
87 0.44
88 0.41
89 0.38
90 0.36
91 0.42
92 0.45
93 0.44
94 0.46
95 0.42
96 0.46
97 0.52
98 0.52
99 0.49
100 0.51
101 0.52
102 0.5
103 0.52