Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C3P0F3

Protein Details
Accession A0A5C3P0F3    Localization Confidence Low Confidence Score 5.4
NoLS Segment(s)
PositionSequenceProtein Nature
44-64IYNASKRCREVQRRTTGRSRGHydrophilic
NLS Segment(s)
Subcellular Location(s) cysk 22, mito 2, nucl 1, cyto 1, plas 1, cyto_nucl 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR011993  PH-like_dom_sf  
IPR001849  PH_domain  
PROSITE View protein in PROSITE  
PS50003  PH_DOMAIN  
Amino Acid Sequences MRPEELIILDDQTFQLVVAYPRGGDSVGLRASSVRECQTWMEAIYNASKRCREVQRRTTGRSRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.07
3 0.07
4 0.08
5 0.09
6 0.09
7 0.08
8 0.09
9 0.09
10 0.09
11 0.07
12 0.07
13 0.1
14 0.1
15 0.1
16 0.1
17 0.1
18 0.11
19 0.12
20 0.13
21 0.1
22 0.1
23 0.11
24 0.12
25 0.13
26 0.13
27 0.13
28 0.12
29 0.11
30 0.12
31 0.17
32 0.2
33 0.21
34 0.24
35 0.25
36 0.26
37 0.34
38 0.43
39 0.48
40 0.55
41 0.63
42 0.71
43 0.77
44 0.81