Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3PJZ9

Protein Details
Accession A0A5C3PJZ9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
36-55NSKHKTRRTWLPNVHNKRLFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23, cyto 2.5, cyto_pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR034704  L28p-like  
IPR026569  Ribo_L28/L24  
IPR037147  Ribo_L28/L24_sf  
IPR001383  Ribosomal_L28  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00830  Ribosomal_L28  
Amino Acid Sequences MFPSIPLWEVVSTPFKRSQLGLFQGKMKQYGNSVPNSKHKTRRTWLPNVHNKRLFSDTLGQNLRIKLTTRALKTIKKHGGVDNYLLKMKPELLGWEGMRLRVMVREKQQAAAAEEGAKVDS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.29
3 0.3
4 0.31
5 0.33
6 0.32
7 0.39
8 0.4
9 0.37
10 0.41
11 0.43
12 0.43
13 0.41
14 0.34
15 0.28
16 0.25
17 0.3
18 0.3
19 0.32
20 0.35
21 0.36
22 0.44
23 0.5
24 0.53
25 0.55
26 0.58
27 0.6
28 0.62
29 0.68
30 0.67
31 0.69
32 0.72
33 0.73
34 0.78
35 0.77
36 0.8
37 0.74
38 0.67
39 0.6
40 0.54
41 0.44
42 0.36
43 0.34
44 0.27
45 0.29
46 0.29
47 0.27
48 0.25
49 0.25
50 0.23
51 0.17
52 0.17
53 0.14
54 0.19
55 0.24
56 0.23
57 0.3
58 0.33
59 0.38
60 0.4
61 0.47
62 0.47
63 0.45
64 0.46
65 0.44
66 0.46
67 0.43
68 0.44
69 0.38
70 0.34
71 0.33
72 0.3
73 0.26
74 0.21
75 0.2
76 0.16
77 0.12
78 0.12
79 0.12
80 0.17
81 0.17
82 0.22
83 0.22
84 0.21
85 0.21
86 0.18
87 0.17
88 0.19
89 0.24
90 0.24
91 0.3
92 0.39
93 0.39
94 0.41
95 0.45
96 0.42
97 0.4
98 0.36
99 0.31
100 0.23
101 0.22