Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C3NZS4

Protein Details
Accession A0A5C3NZS4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
5-28NHLASPPRARRSRRSRSEDRRVLAHydrophilic
NLS Segment(s)
PositionSequence
12-20RARRSRRSR
Subcellular Location(s) mito 21, cyto 4
Family & Domain DBs
Amino Acid Sequences MCVVNHLASPPRARRSRRSRSEDRRVLAGHVGAPSRVLSNAVARPALCDSWHPRTPDTRGAADLYPATRREDGVRSGAGPDRTAAWQARAAGRPGTRNDGGPPPY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.69
3 0.76
4 0.79
5 0.81
6 0.83
7 0.85
8 0.91
9 0.88
10 0.8
11 0.74
12 0.64
13 0.57
14 0.48
15 0.38
16 0.29
17 0.22
18 0.2
19 0.14
20 0.14
21 0.12
22 0.11
23 0.1
24 0.09
25 0.08
26 0.11
27 0.13
28 0.13
29 0.14
30 0.13
31 0.14
32 0.14
33 0.14
34 0.1
35 0.12
36 0.16
37 0.22
38 0.26
39 0.26
40 0.26
41 0.29
42 0.33
43 0.36
44 0.34
45 0.28
46 0.25
47 0.26
48 0.25
49 0.23
50 0.2
51 0.15
52 0.14
53 0.14
54 0.16
55 0.14
56 0.15
57 0.17
58 0.19
59 0.2
60 0.21
61 0.21
62 0.18
63 0.2
64 0.23
65 0.21
66 0.19
67 0.17
68 0.16
69 0.16
70 0.19
71 0.18
72 0.17
73 0.19
74 0.21
75 0.26
76 0.27
77 0.28
78 0.3
79 0.32
80 0.35
81 0.36
82 0.41
83 0.37
84 0.36
85 0.38