Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3PCC9

Protein Details
Accession A0A5C3PCC9    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
2-29HEAPPPPGRSRRGRPRTRRRADLYPDSSBasic
NLS Segment(s)
PositionSequence
7-21PPGRSRRGRPRTRRR
Subcellular Location(s) nucl 15, cyto_nucl 10.5, mito 8, cyto 4
Family & Domain DBs
Amino Acid Sequences MHEAPPPPGRSRRGRPRTRRRADLYPDSSRTSARALTASSRAATTSGAETVRWRALLLGRRRFDTSRTAELARKDLEAATT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.84
3 0.88
4 0.92
5 0.92
6 0.91
7 0.87
8 0.85
9 0.82
10 0.81
11 0.77
12 0.73
13 0.67
14 0.6
15 0.54
16 0.44
17 0.37
18 0.29
19 0.22
20 0.16
21 0.14
22 0.12
23 0.13
24 0.15
25 0.14
26 0.13
27 0.12
28 0.11
29 0.11
30 0.1
31 0.08
32 0.07
33 0.08
34 0.08
35 0.08
36 0.09
37 0.12
38 0.13
39 0.12
40 0.11
41 0.11
42 0.15
43 0.23
44 0.31
45 0.38
46 0.39
47 0.42
48 0.46
49 0.46
50 0.43
51 0.44
52 0.41
53 0.39
54 0.41
55 0.41
56 0.41
57 0.43
58 0.46
59 0.38
60 0.33
61 0.27