Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3NXA1

Protein Details
Accession A0A5C3NXA1    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-42MPPAPRRRRVRTPEEEARSKQLRKERNHRHYIKKRGRAAGNHBasic
NLS Segment(s)
PositionSequence
5-38PRRRRVRTPEEEARSKQLRKERNHRHYIKKRGRA
Subcellular Location(s) nucl 17, cyto_nucl 11, mito 7
Family & Domain DBs
Amino Acid Sequences MPPAPRRRRVRTPEEEARSKQLRKERNHRHYIKKRGRAAGNHQTAATTTQQSGEDVQDIHAVSSHPSQGDFNGDSEPHSLNATVAAFLPPESSVLQAGASPLRIPSTSTPSHASRLVALNEALLDWGYMEDRAAYSRSLDKQLRRARRADEATRTTWVNEMDEWIADGDSMVEELQDVARHDFDSTTLSVVFNVLYMIAAAEARLYFV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.83
3 0.75
4 0.75
5 0.72
6 0.66
7 0.63
8 0.61
9 0.61
10 0.64
11 0.71
12 0.74
13 0.76
14 0.84
15 0.86
16 0.89
17 0.9
18 0.91
19 0.9
20 0.89
21 0.86
22 0.84
23 0.82
24 0.79
25 0.78
26 0.77
27 0.73
28 0.65
29 0.56
30 0.48
31 0.41
32 0.36
33 0.29
34 0.2
35 0.14
36 0.15
37 0.15
38 0.16
39 0.17
40 0.15
41 0.13
42 0.12
43 0.12
44 0.12
45 0.12
46 0.11
47 0.11
48 0.1
49 0.1
50 0.12
51 0.12
52 0.1
53 0.11
54 0.11
55 0.11
56 0.14
57 0.14
58 0.13
59 0.13
60 0.13
61 0.13
62 0.14
63 0.14
64 0.11
65 0.11
66 0.1
67 0.08
68 0.09
69 0.09
70 0.07
71 0.07
72 0.06
73 0.06
74 0.06
75 0.06
76 0.05
77 0.06
78 0.06
79 0.06
80 0.06
81 0.06
82 0.06
83 0.06
84 0.06
85 0.06
86 0.05
87 0.05
88 0.05
89 0.06
90 0.06
91 0.07
92 0.08
93 0.14
94 0.14
95 0.16
96 0.2
97 0.21
98 0.23
99 0.23
100 0.21
101 0.17
102 0.2
103 0.18
104 0.15
105 0.14
106 0.12
107 0.1
108 0.1
109 0.08
110 0.05
111 0.04
112 0.03
113 0.03
114 0.03
115 0.03
116 0.03
117 0.04
118 0.04
119 0.05
120 0.06
121 0.06
122 0.08
123 0.12
124 0.15
125 0.22
126 0.26
127 0.29
128 0.38
129 0.47
130 0.55
131 0.55
132 0.57
133 0.53
134 0.58
135 0.61
136 0.58
137 0.58
138 0.53
139 0.51
140 0.5
141 0.46
142 0.38
143 0.33
144 0.28
145 0.2
146 0.16
147 0.16
148 0.14
149 0.13
150 0.13
151 0.11
152 0.09
153 0.08
154 0.07
155 0.05
156 0.05
157 0.05
158 0.04
159 0.04
160 0.04
161 0.04
162 0.06
163 0.07
164 0.09
165 0.1
166 0.11
167 0.12
168 0.13
169 0.13
170 0.12
171 0.14
172 0.13
173 0.13
174 0.12
175 0.12
176 0.12
177 0.12
178 0.11
179 0.08
180 0.07
181 0.05
182 0.05
183 0.05
184 0.05
185 0.05
186 0.05
187 0.04
188 0.06