Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3P060

Protein Details
Accession A0A5C3P060    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
80-118AVGSRQGHTGRRRRRRRRLASTRPTRRRRPSLRGASGSEBasic
NLS Segment(s)
PositionSequence
84-122RQGHTGRRRRRRRRLASTRPTRRRRPSLRGASGSEHARI
Subcellular Location(s) nucl 10, cyto 7, mito 6, extr 2
Family & Domain DBs
Amino Acid Sequences MERQHGTECAVAHQLTEAWATVMRFAAVRASRYYVDARDADRWICRCVSLAPRSPRTAVSSRGLNASGEFADGCAESRRAVGSRQGHTGRRRRRRRRLASTRPTRRRRPSLRGASGSEHARIRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.13
3 0.13
4 0.11
5 0.08
6 0.1
7 0.1
8 0.1
9 0.1
10 0.09
11 0.09
12 0.09
13 0.15
14 0.15
15 0.17
16 0.18
17 0.2
18 0.21
19 0.23
20 0.25
21 0.2
22 0.22
23 0.22
24 0.22
25 0.22
26 0.23
27 0.22
28 0.24
29 0.24
30 0.23
31 0.21
32 0.19
33 0.17
34 0.18
35 0.25
36 0.26
37 0.32
38 0.37
39 0.4
40 0.42
41 0.42
42 0.4
43 0.37
44 0.35
45 0.3
46 0.27
47 0.25
48 0.24
49 0.24
50 0.23
51 0.18
52 0.15
53 0.12
54 0.09
55 0.07
56 0.06
57 0.05
58 0.05
59 0.05
60 0.06
61 0.06
62 0.07
63 0.07
64 0.07
65 0.09
66 0.09
67 0.1
68 0.17
69 0.22
70 0.24
71 0.31
72 0.35
73 0.41
74 0.49
75 0.57
76 0.61
77 0.65
78 0.74
79 0.78
80 0.85
81 0.9
82 0.92
83 0.94
84 0.95
85 0.95
86 0.95
87 0.95
88 0.95
89 0.95
90 0.93
91 0.92
92 0.91
93 0.91
94 0.89
95 0.87
96 0.87
97 0.87
98 0.87
99 0.82
100 0.76
101 0.7
102 0.66
103 0.6
104 0.53