Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3NYX1

Protein Details
Accession A0A5C3NYX1    Localization Confidence Low Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
119-146AVSPCLQRLRLRRQRRSQNPGRACNRSVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, nucl 8, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR043170  PTPA_C_lid  
IPR037218  PTPA_sf  
Gene Ontology GO:0003755  F:peptidyl-prolyl cis-trans isomerase activity  
GO:0019211  F:phosphatase activator activity  
Amino Acid Sequences MNFAMLRQRSSRSTTCISPAFSSSNCLTTPAFAHARRHLSRQDLGQIELGSIYMYHAEVLGKFPVMQQILFDSSLAWIALLPRTCLAPPRPRTRRRVLGPHSPIAGGSVSSRTGEAIAAVSPCLQRLRLRRQRRSQNPGRACNRSVPFN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.44
3 0.43
4 0.42
5 0.37
6 0.36
7 0.33
8 0.29
9 0.3
10 0.26
11 0.24
12 0.22
13 0.22
14 0.19
15 0.17
16 0.19
17 0.19
18 0.24
19 0.24
20 0.29
21 0.33
22 0.41
23 0.42
24 0.45
25 0.43
26 0.43
27 0.43
28 0.4
29 0.41
30 0.34
31 0.34
32 0.31
33 0.27
34 0.22
35 0.19
36 0.16
37 0.08
38 0.07
39 0.06
40 0.04
41 0.04
42 0.04
43 0.04
44 0.04
45 0.05
46 0.06
47 0.07
48 0.06
49 0.06
50 0.07
51 0.1
52 0.1
53 0.1
54 0.08
55 0.1
56 0.11
57 0.11
58 0.11
59 0.07
60 0.07
61 0.07
62 0.07
63 0.05
64 0.04
65 0.04
66 0.06
67 0.06
68 0.07
69 0.07
70 0.08
71 0.08
72 0.12
73 0.17
74 0.24
75 0.31
76 0.41
77 0.51
78 0.57
79 0.65
80 0.7
81 0.74
82 0.72
83 0.75
84 0.71
85 0.72
86 0.7
87 0.66
88 0.58
89 0.48
90 0.41
91 0.31
92 0.25
93 0.15
94 0.11
95 0.09
96 0.09
97 0.09
98 0.09
99 0.08
100 0.08
101 0.08
102 0.07
103 0.06
104 0.07
105 0.07
106 0.07
107 0.09
108 0.09
109 0.1
110 0.11
111 0.13
112 0.18
113 0.27
114 0.38
115 0.47
116 0.58
117 0.67
118 0.76
119 0.85
120 0.9
121 0.92
122 0.91
123 0.92
124 0.9
125 0.9
126 0.88
127 0.83
128 0.75
129 0.74