Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C3PRL6

Protein Details
Accession A0A5C3PRL6    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
81-123PLDLRNKKTRAIRRRLTKHEASVKTLKQRKKDIHFPIRKYAVKHydrophilic
NLS Segment(s)
PositionSequence
85-116RNKKTRAIRRRLTKHEASVKTLKQRKKDIHFP
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR018254  Ribosomal_L29_CS  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
PROSITE View protein in PROSITE  
PS00579  RIBOSOMAL_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MPGKVKAYELQSKSKNDLSKQLAELKTELLTLRVQKIAGGSAAKLTKINTVRKSIARVLTVMNQKARQNLREFYKNKKYLPLDLRNKKTRAIRRRLTKHEASVKTLKQRKKDIHFPIRKYAVKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.55
3 0.48
4 0.53
5 0.5
6 0.49
7 0.48
8 0.52
9 0.48
10 0.44
11 0.41
12 0.34
13 0.28
14 0.24
15 0.2
16 0.13
17 0.14
18 0.15
19 0.16
20 0.16
21 0.15
22 0.15
23 0.16
24 0.15
25 0.14
26 0.12
27 0.09
28 0.12
29 0.13
30 0.13
31 0.13
32 0.12
33 0.17
34 0.22
35 0.29
36 0.29
37 0.33
38 0.36
39 0.37
40 0.41
41 0.39
42 0.36
43 0.29
44 0.27
45 0.23
46 0.26
47 0.28
48 0.26
49 0.24
50 0.24
51 0.24
52 0.3
53 0.31
54 0.29
55 0.29
56 0.31
57 0.35
58 0.41
59 0.42
60 0.45
61 0.53
62 0.54
63 0.51
64 0.55
65 0.52
66 0.51
67 0.58
68 0.6
69 0.6
70 0.64
71 0.72
72 0.72
73 0.71
74 0.68
75 0.68
76 0.68
77 0.67
78 0.68
79 0.69
80 0.72
81 0.8
82 0.84
83 0.83
84 0.79
85 0.77
86 0.77
87 0.71
88 0.67
89 0.66
90 0.62
91 0.64
92 0.66
93 0.63
94 0.61
95 0.68
96 0.71
97 0.72
98 0.77
99 0.77
100 0.81
101 0.84
102 0.81
103 0.82
104 0.81