Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3P5Y9

Protein Details
Accession A0A5C3P5Y9    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
8-36PTSSSSSKAAKKKKWSKGKVKDKAQHAVVHydrophilic
NLS Segment(s)
PositionSequence
14-30SKAAKKKKWSKGKVKDK
Subcellular Location(s) nucl 13, mito 10, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAKAKAAPTSSSSSKAAKKKKWSKGKVKDKAQHAVVLDKPTYDRILKEVPTFRFISQSILIERLKINGSLARVAIRHLEKEGQIKRIVHHSGQLIYTRSTGGGAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.48
3 0.54
4 0.56
5 0.64
6 0.71
7 0.78
8 0.83
9 0.86
10 0.88
11 0.9
12 0.92
13 0.91
14 0.91
15 0.88
16 0.84
17 0.81
18 0.71
19 0.63
20 0.53
21 0.47
22 0.4
23 0.36
24 0.29
25 0.22
26 0.21
27 0.19
28 0.2
29 0.16
30 0.14
31 0.14
32 0.17
33 0.18
34 0.22
35 0.26
36 0.25
37 0.28
38 0.29
39 0.25
40 0.24
41 0.23
42 0.22
43 0.18
44 0.18
45 0.15
46 0.17
47 0.17
48 0.16
49 0.15
50 0.14
51 0.14
52 0.12
53 0.12
54 0.11
55 0.12
56 0.12
57 0.13
58 0.12
59 0.12
60 0.12
61 0.17
62 0.17
63 0.17
64 0.18
65 0.2
66 0.21
67 0.3
68 0.33
69 0.31
70 0.35
71 0.35
72 0.35
73 0.4
74 0.42
75 0.34
76 0.35
77 0.34
78 0.31
79 0.33
80 0.35
81 0.29
82 0.27
83 0.26
84 0.22
85 0.19