Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3PBV8

Protein Details
Accession A0A5C3PBV8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
18-37SQSTKSQGRARERRRSIRVFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23, plas 2
Family & Domain DBs
Amino Acid Sequences MSGRKGTRPMTALKESGSQSTKSQGRARERRRSIRVFTLQLRPLLLVVRASMVVAASASPGIRMKGARPRARPHSAWRFRCLNGGNIAEKTVLITRGAGVTIDSG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.36
3 0.39
4 0.35
5 0.3
6 0.26
7 0.33
8 0.34
9 0.35
10 0.39
11 0.41
12 0.49
13 0.58
14 0.66
15 0.68
16 0.74
17 0.78
18 0.81
19 0.79
20 0.74
21 0.72
22 0.69
23 0.64
24 0.59
25 0.57
26 0.51
27 0.46
28 0.41
29 0.31
30 0.25
31 0.21
32 0.17
33 0.1
34 0.07
35 0.07
36 0.06
37 0.06
38 0.05
39 0.04
40 0.04
41 0.03
42 0.03
43 0.03
44 0.03
45 0.03
46 0.04
47 0.04
48 0.05
49 0.06
50 0.07
51 0.1
52 0.19
53 0.28
54 0.35
55 0.4
56 0.47
57 0.54
58 0.6
59 0.61
60 0.62
61 0.64
62 0.67
63 0.66
64 0.64
65 0.61
66 0.55
67 0.59
68 0.51
69 0.44
70 0.4
71 0.39
72 0.36
73 0.32
74 0.32
75 0.25
76 0.23
77 0.2
78 0.17
79 0.14
80 0.12
81 0.12
82 0.12
83 0.12
84 0.13
85 0.11