Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3P5H0

Protein Details
Accession A0A5C3P5H0    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
38-63AVATVTSGRRRRKRRFGLPRRTPATHHydrophilic
NLS Segment(s)
PositionSequence
46-58RRRRKRRFGLPRR
Subcellular Location(s) nucl 17.5, cyto_nucl 10.5, mito 6
Family & Domain DBs
Amino Acid Sequences MNHHNPRLYCSRLTRHVWAKLAEDASTAGSSCGCTFSAVATVTSGRRRRKRRFGLPRRTPATHLHWQLSSFRTSSLLIARHVHLRLDTLLPPALARSCLRSIASSRTRRGTGSRPLALAHQGRRARNRFAALVPNPVELSMATPRPLRLSCKTRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.62
3 0.64
4 0.62
5 0.57
6 0.52
7 0.49
8 0.45
9 0.36
10 0.29
11 0.22
12 0.2
13 0.17
14 0.14
15 0.09
16 0.08
17 0.09
18 0.08
19 0.09
20 0.08
21 0.08
22 0.08
23 0.09
24 0.12
25 0.12
26 0.11
27 0.11
28 0.12
29 0.14
30 0.22
31 0.28
32 0.34
33 0.43
34 0.53
35 0.62
36 0.72
37 0.8
38 0.83
39 0.88
40 0.9
41 0.92
42 0.92
43 0.91
44 0.86
45 0.78
46 0.7
47 0.64
48 0.6
49 0.56
50 0.49
51 0.42
52 0.36
53 0.35
54 0.35
55 0.31
56 0.25
57 0.17
58 0.14
59 0.14
60 0.13
61 0.13
62 0.14
63 0.13
64 0.13
65 0.15
66 0.15
67 0.17
68 0.17
69 0.16
70 0.13
71 0.13
72 0.12
73 0.13
74 0.13
75 0.11
76 0.11
77 0.11
78 0.1
79 0.1
80 0.09
81 0.09
82 0.09
83 0.11
84 0.12
85 0.14
86 0.15
87 0.16
88 0.18
89 0.25
90 0.34
91 0.36
92 0.38
93 0.41
94 0.42
95 0.42
96 0.44
97 0.42
98 0.43
99 0.44
100 0.43
101 0.39
102 0.39
103 0.39
104 0.4
105 0.39
106 0.32
107 0.33
108 0.36
109 0.41
110 0.5
111 0.53
112 0.53
113 0.53
114 0.54
115 0.48
116 0.46
117 0.5
118 0.43
119 0.46
120 0.41
121 0.38
122 0.34
123 0.31
124 0.28
125 0.18
126 0.2
127 0.17
128 0.18
129 0.19
130 0.2
131 0.22
132 0.26
133 0.29
134 0.32
135 0.36