Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3N6G7

Protein Details
Accession A0A5C3N6G7   
Localization Confidence Medium
Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
16-46IRPAHPPSPSKHQQRKTPRTPDPPKSRPVRAHydrophilic
NLS Segment(s)
PositionSequence
31-31K
Subcellular Location(s) nucl 13, mito 11, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR009349  Znf_C2HC5  
Gene Ontology GO:0005634  C:nucleus  
GO:0008270  F:zinc ion binding  
GO:0006355  P:regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF06221  zf-C2HC5  
Amino Acid Sequences MSTPWTHPSSLPSDRIRPAHPPSPSKHQQRKTPRTPDPPKSRPVRALETLVRGLQNTPERTPDPKGGCFCRARLHALSRYTPLCAACGLVLCTVNAPHFACPHCASPLLAPPARQSLLLQLQAQIAQTLASEESARLKAADDARRAAGAFPALSASASDQSVASQTHKVLSLNSKTKKVTVASYSPSPVSTPKVLEEEEPERVPPPPPDVLYVKARPDARRPWMNVREPPPSYVPLGRKDRANK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.53
3 0.51
4 0.51
5 0.53
6 0.53
7 0.55
8 0.55
9 0.55
10 0.62
11 0.68
12 0.71
13 0.74
14 0.75
15 0.78
16 0.82
17 0.87
18 0.88
19 0.89
20 0.87
21 0.88
22 0.9
23 0.9
24 0.9
25 0.85
26 0.84
27 0.8
28 0.77
29 0.74
30 0.7
31 0.67
32 0.6
33 0.6
34 0.55
35 0.52
36 0.47
37 0.41
38 0.35
39 0.28
40 0.25
41 0.25
42 0.28
43 0.27
44 0.26
45 0.29
46 0.31
47 0.34
48 0.37
49 0.39
50 0.36
51 0.38
52 0.42
53 0.42
54 0.46
55 0.45
56 0.42
57 0.42
58 0.4
59 0.4
60 0.39
61 0.41
62 0.4
63 0.42
64 0.42
65 0.39
66 0.37
67 0.32
68 0.3
69 0.23
70 0.18
71 0.14
72 0.12
73 0.09
74 0.09
75 0.09
76 0.08
77 0.08
78 0.07
79 0.08
80 0.08
81 0.08
82 0.09
83 0.09
84 0.09
85 0.11
86 0.12
87 0.15
88 0.16
89 0.17
90 0.16
91 0.16
92 0.16
93 0.15
94 0.19
95 0.21
96 0.19
97 0.18
98 0.18
99 0.21
100 0.21
101 0.2
102 0.15
103 0.15
104 0.17
105 0.19
106 0.18
107 0.16
108 0.16
109 0.16
110 0.16
111 0.11
112 0.07
113 0.05
114 0.05
115 0.04
116 0.04
117 0.04
118 0.04
119 0.04
120 0.07
121 0.07
122 0.08
123 0.07
124 0.08
125 0.11
126 0.17
127 0.22
128 0.21
129 0.23
130 0.23
131 0.23
132 0.23
133 0.19
134 0.14
135 0.1
136 0.08
137 0.06
138 0.06
139 0.06
140 0.06
141 0.06
142 0.06
143 0.07
144 0.07
145 0.07
146 0.06
147 0.07
148 0.08
149 0.09
150 0.1
151 0.1
152 0.11
153 0.12
154 0.13
155 0.14
156 0.15
157 0.2
158 0.27
159 0.34
160 0.38
161 0.41
162 0.41
163 0.42
164 0.44
165 0.39
166 0.36
167 0.32
168 0.33
169 0.33
170 0.35
171 0.35
172 0.32
173 0.3
174 0.26
175 0.23
176 0.22
177 0.2
178 0.19
179 0.19
180 0.22
181 0.22
182 0.23
183 0.26
184 0.26
185 0.27
186 0.27
187 0.25
188 0.23
189 0.24
190 0.25
191 0.22
192 0.23
193 0.23
194 0.23
195 0.27
196 0.29
197 0.33
198 0.38
199 0.39
200 0.38
201 0.39
202 0.43
203 0.43
204 0.48
205 0.52
206 0.54
207 0.58
208 0.61
209 0.66
210 0.7
211 0.74
212 0.75
213 0.72
214 0.72
215 0.66
216 0.64
217 0.57
218 0.51
219 0.47
220 0.46
221 0.45
222 0.45
223 0.51
224 0.51