Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C3N4H1

Protein Details
Accession A0A5C3N4H1    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MPKETRKGRTAKRVSNPYELIHydrophilic
NLS Segment(s)
PositionSequence
117-122RRVRGH
Subcellular Location(s) mito 14, nucl 10, cyto 2
Family & Domain DBs
Amino Acid Sequences MPKETRKGRTAKRVSNPYELIERIQGLMGRVEPGDRIENWRKQVMPEKFGDKAMSGQVERGRCADRRPVRGGGMVEAPSSPCARKMGGGVARKRTVRFAEEGGDKGGNGMDVKGPERRVRGHKKSSASLENPTITDLQAHNANKKSATAPQRDIAMVNLQYYLENLTMHDDPKES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.8
3 0.73
4 0.65
5 0.61
6 0.52
7 0.44
8 0.36
9 0.31
10 0.23
11 0.22
12 0.2
13 0.15
14 0.15
15 0.14
16 0.12
17 0.12
18 0.12
19 0.11
20 0.12
21 0.14
22 0.14
23 0.21
24 0.28
25 0.34
26 0.37
27 0.4
28 0.38
29 0.4
30 0.49
31 0.46
32 0.43
33 0.41
34 0.41
35 0.39
36 0.39
37 0.36
38 0.26
39 0.23
40 0.2
41 0.2
42 0.16
43 0.17
44 0.2
45 0.2
46 0.2
47 0.21
48 0.21
49 0.2
50 0.23
51 0.29
52 0.32
53 0.37
54 0.41
55 0.42
56 0.4
57 0.42
58 0.39
59 0.31
60 0.27
61 0.21
62 0.16
63 0.13
64 0.12
65 0.1
66 0.11
67 0.09
68 0.08
69 0.09
70 0.09
71 0.09
72 0.1
73 0.15
74 0.21
75 0.27
76 0.29
77 0.33
78 0.36
79 0.37
80 0.37
81 0.34
82 0.3
83 0.26
84 0.25
85 0.21
86 0.22
87 0.22
88 0.23
89 0.2
90 0.18
91 0.15
92 0.14
93 0.12
94 0.08
95 0.07
96 0.06
97 0.06
98 0.07
99 0.09
100 0.12
101 0.15
102 0.18
103 0.21
104 0.26
105 0.34
106 0.44
107 0.52
108 0.57
109 0.62
110 0.64
111 0.66
112 0.67
113 0.65
114 0.57
115 0.53
116 0.48
117 0.42
118 0.37
119 0.33
120 0.27
121 0.19
122 0.19
123 0.15
124 0.14
125 0.19
126 0.21
127 0.26
128 0.28
129 0.3
130 0.28
131 0.29
132 0.29
133 0.3
134 0.37
135 0.38
136 0.4
137 0.41
138 0.43
139 0.41
140 0.4
141 0.34
142 0.32
143 0.25
144 0.21
145 0.19
146 0.17
147 0.16
148 0.16
149 0.16
150 0.11
151 0.1
152 0.1
153 0.14
154 0.16
155 0.17