Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C4QZI9

Protein Details
Accession C4QZI9    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
521-544RYQFDSIKAPSRKRERDNNDSELVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, mito_nucl 10, cyto 5, cysk 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR003347  JmjC_dom  
IPR003349  JmjN  
IPR013083  Znf_RING/FYVE/PHD  
Gene Ontology GO:0001227  F:DNA-binding transcription repressor activity, RNA polymerase II-specific  
GO:0051864  F:histone H3K36 demethylase activity  
GO:0032454  F:histone H3K9 demethylase activity  
GO:0043565  F:sequence-specific DNA binding  
GO:0010507  P:negative regulation of autophagy  
GO:0032968  P:positive regulation of transcription elongation by RNA polymerase II  
KEGG ppa:PAS_chr2-1_0062  -  
Pfam View protein in Pfam  
PF02373  JmjC  
PF02375  JmjN  
PROSITE View protein in PROSITE  
PS51184  JMJC  
PS51183  JMJN  
Amino Acid Sequences MTRAIKPDHYEQGIPVFKPSTDQFEDFYAFNKAVHPYGMQSGIIKVIPPSDWIDSLHDSPDYLTQEDLLNVKLKNPIEQQVSLMSNKSCFSIDNVEKHRTYTLPQWKKLHDQLKYSLPRPRGAKSDTFNSKDGPIPKEKEGEFTAKIDTSIYEPDYIEFLESQYWKSLKFSAPLYAADSLGSLFPKNLKTWNVSSLPNLLDYLPEKIPGVNDSYLYAGLWKATFSWHLEDQDLHSINYIHFGAPKKWYSIPQDQHREFYQLMSNTYPDDAKHCPEFLRHKTFLVDPKYIRSNGITVNEIVHREKEFIITYPYGYHSGFNLGYNLAESVNFAIEEWLPIGLRAKKCECIDDSVGIDVRKLMESVSKCILCPTLMQKNIFQESFDKLLILGTNSKAHRICGKLIPGLEVDGDLITKYFSMIDNTKLSICNYCGEGGYCVSCSFQDCTNCYHVLCSLNSNVSIDRCKIYCELHKGEAVTTFDSLEIGDIISFDSKYGEIVSLDKEKETTTMATFPEAQHKLIHRYQFDSIKAPSRKRERDNNDSELVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.38
3 0.32
4 0.28
5 0.31
6 0.32
7 0.31
8 0.31
9 0.32
10 0.3
11 0.32
12 0.35
13 0.3
14 0.3
15 0.25
16 0.2
17 0.19
18 0.2
19 0.19
20 0.18
21 0.2
22 0.19
23 0.18
24 0.21
25 0.23
26 0.2
27 0.19
28 0.18
29 0.19
30 0.18
31 0.16
32 0.13
33 0.13
34 0.13
35 0.15
36 0.17
37 0.18
38 0.19
39 0.2
40 0.24
41 0.26
42 0.27
43 0.26
44 0.22
45 0.2
46 0.2
47 0.23
48 0.21
49 0.18
50 0.17
51 0.16
52 0.17
53 0.18
54 0.18
55 0.15
56 0.16
57 0.16
58 0.18
59 0.23
60 0.23
61 0.27
62 0.3
63 0.35
64 0.36
65 0.37
66 0.36
67 0.36
68 0.38
69 0.33
70 0.32
71 0.26
72 0.23
73 0.22
74 0.22
75 0.17
76 0.15
77 0.17
78 0.24
79 0.28
80 0.35
81 0.41
82 0.45
83 0.45
84 0.46
85 0.44
86 0.36
87 0.34
88 0.35
89 0.41
90 0.45
91 0.52
92 0.57
93 0.58
94 0.65
95 0.71
96 0.69
97 0.63
98 0.59
99 0.57
100 0.61
101 0.63
102 0.59
103 0.57
104 0.51
105 0.52
106 0.5
107 0.49
108 0.46
109 0.44
110 0.47
111 0.45
112 0.52
113 0.54
114 0.54
115 0.51
116 0.46
117 0.43
118 0.41
119 0.42
120 0.38
121 0.37
122 0.37
123 0.39
124 0.43
125 0.41
126 0.4
127 0.38
128 0.38
129 0.32
130 0.29
131 0.29
132 0.23
133 0.23
134 0.19
135 0.16
136 0.13
137 0.14
138 0.13
139 0.13
140 0.12
141 0.13
142 0.13
143 0.13
144 0.11
145 0.09
146 0.08
147 0.11
148 0.11
149 0.12
150 0.15
151 0.16
152 0.15
153 0.17
154 0.21
155 0.2
156 0.22
157 0.22
158 0.23
159 0.24
160 0.24
161 0.25
162 0.22
163 0.2
164 0.17
165 0.15
166 0.11
167 0.1
168 0.09
169 0.07
170 0.06
171 0.09
172 0.11
173 0.12
174 0.16
175 0.18
176 0.22
177 0.24
178 0.29
179 0.29
180 0.29
181 0.29
182 0.28
183 0.26
184 0.22
185 0.2
186 0.14
187 0.13
188 0.13
189 0.15
190 0.12
191 0.12
192 0.12
193 0.11
194 0.12
195 0.12
196 0.14
197 0.11
198 0.11
199 0.11
200 0.12
201 0.11
202 0.1
203 0.1
204 0.06
205 0.06
206 0.06
207 0.05
208 0.05
209 0.06
210 0.08
211 0.09
212 0.12
213 0.14
214 0.15
215 0.16
216 0.16
217 0.17
218 0.21
219 0.2
220 0.17
221 0.15
222 0.15
223 0.14
224 0.16
225 0.14
226 0.08
227 0.11
228 0.13
229 0.14
230 0.18
231 0.2
232 0.2
233 0.21
234 0.26
235 0.29
236 0.37
237 0.42
238 0.47
239 0.55
240 0.54
241 0.55
242 0.51
243 0.47
244 0.38
245 0.32
246 0.27
247 0.19
248 0.19
249 0.17
250 0.16
251 0.14
252 0.14
253 0.13
254 0.09
255 0.11
256 0.11
257 0.13
258 0.14
259 0.14
260 0.14
261 0.18
262 0.26
263 0.3
264 0.36
265 0.34
266 0.34
267 0.35
268 0.38
269 0.4
270 0.37
271 0.34
272 0.27
273 0.3
274 0.32
275 0.31
276 0.29
277 0.23
278 0.2
279 0.18
280 0.2
281 0.17
282 0.14
283 0.15
284 0.16
285 0.17
286 0.15
287 0.14
288 0.12
289 0.13
290 0.13
291 0.13
292 0.12
293 0.12
294 0.14
295 0.13
296 0.13
297 0.13
298 0.14
299 0.14
300 0.14
301 0.13
302 0.1
303 0.13
304 0.13
305 0.12
306 0.11
307 0.09
308 0.09
309 0.09
310 0.09
311 0.06
312 0.05
313 0.05
314 0.05
315 0.05
316 0.05
317 0.05
318 0.05
319 0.05
320 0.06
321 0.06
322 0.05
323 0.05
324 0.05
325 0.1
326 0.14
327 0.16
328 0.2
329 0.22
330 0.28
331 0.28
332 0.32
333 0.3
334 0.3
335 0.31
336 0.28
337 0.27
338 0.23
339 0.24
340 0.2
341 0.18
342 0.13
343 0.11
344 0.1
345 0.09
346 0.08
347 0.11
348 0.13
349 0.17
350 0.21
351 0.21
352 0.2
353 0.21
354 0.22
355 0.17
356 0.18
357 0.21
358 0.25
359 0.28
360 0.3
361 0.31
362 0.36
363 0.39
364 0.37
365 0.31
366 0.25
367 0.24
368 0.25
369 0.23
370 0.18
371 0.14
372 0.15
373 0.14
374 0.13
375 0.12
376 0.11
377 0.17
378 0.17
379 0.22
380 0.22
381 0.23
382 0.27
383 0.28
384 0.3
385 0.3
386 0.33
387 0.32
388 0.32
389 0.32
390 0.26
391 0.24
392 0.2
393 0.14
394 0.11
395 0.08
396 0.07
397 0.05
398 0.05
399 0.05
400 0.04
401 0.05
402 0.05
403 0.06
404 0.1
405 0.12
406 0.16
407 0.18
408 0.2
409 0.21
410 0.21
411 0.22
412 0.2
413 0.2
414 0.18
415 0.17
416 0.17
417 0.16
418 0.16
419 0.16
420 0.14
421 0.14
422 0.13
423 0.12
424 0.11
425 0.11
426 0.13
427 0.13
428 0.17
429 0.21
430 0.22
431 0.26
432 0.3
433 0.31
434 0.28
435 0.27
436 0.25
437 0.24
438 0.23
439 0.22
440 0.21
441 0.22
442 0.22
443 0.22
444 0.21
445 0.21
446 0.23
447 0.22
448 0.22
449 0.21
450 0.23
451 0.24
452 0.28
453 0.33
454 0.38
455 0.41
456 0.41
457 0.43
458 0.41
459 0.4
460 0.39
461 0.34
462 0.27
463 0.22
464 0.19
465 0.16
466 0.16
467 0.14
468 0.1
469 0.07
470 0.06
471 0.05
472 0.05
473 0.06
474 0.08
475 0.08
476 0.07
477 0.08
478 0.08
479 0.09
480 0.1
481 0.1
482 0.09
483 0.11
484 0.16
485 0.2
486 0.21
487 0.21
488 0.21
489 0.2
490 0.21
491 0.22
492 0.2
493 0.17
494 0.2
495 0.2
496 0.23
497 0.24
498 0.25
499 0.32
500 0.31
501 0.3
502 0.31
503 0.35
504 0.4
505 0.44
506 0.49
507 0.43
508 0.46
509 0.51
510 0.52
511 0.51
512 0.49
513 0.47
514 0.5
515 0.55
516 0.57
517 0.6
518 0.64
519 0.71
520 0.74
521 0.81
522 0.8
523 0.83
524 0.85
525 0.81