Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C3N1V3

Protein Details
Accession A0A5C3N1V3    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
44-68AHKADKNDKGKNKKGKEKSKLEAGLBasic
NLS Segment(s)
PositionSequence
49-63KNDKGKNKKGKEKSK
Subcellular Location(s) nucl 19, cyto_nucl 12.833, cyto 4.5, cyto_pero 3.166
Family & Domain DBs
Amino Acid Sequences MPPKLENPPPSAFAEPSEPSVHKPEDNPKEQLAKSQEENPQVVAHKADKNDKGKNKKGKEKSKLEAGLVQLPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.27
3 0.27
4 0.27
5 0.24
6 0.24
7 0.28
8 0.28
9 0.24
10 0.26
11 0.33
12 0.38
13 0.41
14 0.41
15 0.39
16 0.43
17 0.41
18 0.44
19 0.37
20 0.32
21 0.3
22 0.33
23 0.35
24 0.31
25 0.32
26 0.26
27 0.24
28 0.22
29 0.21
30 0.17
31 0.16
32 0.17
33 0.19
34 0.25
35 0.31
36 0.36
37 0.44
38 0.52
39 0.58
40 0.64
41 0.72
42 0.75
43 0.79
44 0.83
45 0.85
46 0.86
47 0.86
48 0.83
49 0.83
50 0.77
51 0.7
52 0.63
53 0.56