Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3NEE0

Protein Details
Accession A0A5C3NEE0   
Localization Confidence Low
Confidence Score 5.3
NoLS Segment(s)
PositionSequenceProtein Nature
16-40LWKVPWRLSRTRKANQRDRLKKVDSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23, nucl 1, cyto 1, plas 1, cyto_nucl 1, pero 1, cyto_pero 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGAFRPSQPSLGGLLWKVPWRLSRTRKANQRDRLKKVDSVIEAVRASGVECKALTEALQLPKEHEMPAKDKYTAFSPHSRNYRKGIHKVPKFTRITQRVNPKGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.18
3 0.19
4 0.21
5 0.21
6 0.2
7 0.24
8 0.28
9 0.38
10 0.44
11 0.52
12 0.57
13 0.65
14 0.72
15 0.77
16 0.81
17 0.81
18 0.84
19 0.83
20 0.81
21 0.8
22 0.74
23 0.68
24 0.6
25 0.55
26 0.45
27 0.39
28 0.32
29 0.27
30 0.24
31 0.2
32 0.17
33 0.12
34 0.11
35 0.1
36 0.09
37 0.07
38 0.07
39 0.07
40 0.08
41 0.08
42 0.07
43 0.06
44 0.1
45 0.13
46 0.15
47 0.15
48 0.16
49 0.19
50 0.2
51 0.19
52 0.18
53 0.17
54 0.18
55 0.23
56 0.24
57 0.24
58 0.23
59 0.24
60 0.26
61 0.28
62 0.29
63 0.32
64 0.35
65 0.41
66 0.51
67 0.54
68 0.54
69 0.54
70 0.6
71 0.61
72 0.65
73 0.68
74 0.68
75 0.71
76 0.77
77 0.78
78 0.78
79 0.75
80 0.74
81 0.74
82 0.72
83 0.73
84 0.71
85 0.76