Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3NKF9

Protein Details
Accession A0A5C3NKF9   
Localization Confidence Medium
Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MSTSADRGPRRRRSQPKIRIKREESPGIPHydrophilic
302-330ATVLPEDEKPPRRRKSTRRSGSRAGRAQEHydrophilic
NLS Segment(s)
PositionSequence
7-22RGPRRRRSQPKIRIKR
310-326KPPRRRKSTRRSGSRAG
Subcellular Location(s) plas 14, mito 6, E.R. 3, nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR009617  Seipin  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0140042  P:lipid droplet formation  
GO:0006629  P:lipid metabolic process  
Pfam View protein in Pfam  
PF06775  Seipin  
Amino Acid Sequences MSTSADRGPRRRRSQPKIRIKREESPGIPEQSFTSRLLHVPVEIFFDLLSTTLRLLHPLVPYFIPLFIAAFVFPILVLFSVSAGWYVWKNVAVGWETQLYLQYGDGPVPYAEAYLPALVPAQPYDISLHLTVPASESNYALGNFMSSLTLTTPANQTLAYVRRPALVLPPSSRLPLPIPFFSADPTTTSVHLHLLSSYVSGTRNVLAKVELGRKDAWKSIGKGEGRELTVMSASLRGVVVHKGVRGLVSRYPVISASIASSIFLIASFAAFAACMLPLLASVRYDEPSSEGASKPAGLPAPATVLPEDEKPPRRRKSTRRSGSRAGRAQETTGVPESAMPPANDGASTPLRRRRSRLSDSGVLSESE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.9
3 0.92
4 0.92
5 0.94
6 0.94
7 0.9
8 0.89
9 0.86
10 0.85
11 0.76
12 0.72
13 0.69
14 0.63
15 0.56
16 0.47
17 0.41
18 0.35
19 0.35
20 0.29
21 0.25
22 0.22
23 0.23
24 0.25
25 0.23
26 0.2
27 0.19
28 0.18
29 0.2
30 0.18
31 0.17
32 0.14
33 0.13
34 0.12
35 0.11
36 0.11
37 0.06
38 0.07
39 0.1
40 0.1
41 0.12
42 0.14
43 0.17
44 0.2
45 0.21
46 0.23
47 0.2
48 0.22
49 0.21
50 0.19
51 0.16
52 0.12
53 0.11
54 0.09
55 0.09
56 0.07
57 0.07
58 0.07
59 0.06
60 0.05
61 0.05
62 0.05
63 0.04
64 0.04
65 0.04
66 0.04
67 0.05
68 0.05
69 0.05
70 0.05
71 0.06
72 0.07
73 0.08
74 0.09
75 0.1
76 0.1
77 0.1
78 0.13
79 0.13
80 0.13
81 0.14
82 0.14
83 0.13
84 0.13
85 0.14
86 0.12
87 0.11
88 0.1
89 0.09
90 0.08
91 0.09
92 0.08
93 0.08
94 0.07
95 0.08
96 0.08
97 0.07
98 0.06
99 0.06
100 0.07
101 0.06
102 0.06
103 0.06
104 0.06
105 0.06
106 0.07
107 0.06
108 0.07
109 0.07
110 0.08
111 0.09
112 0.09
113 0.11
114 0.11
115 0.11
116 0.11
117 0.11
118 0.1
119 0.1
120 0.1
121 0.09
122 0.09
123 0.09
124 0.09
125 0.1
126 0.1
127 0.09
128 0.08
129 0.06
130 0.06
131 0.06
132 0.05
133 0.04
134 0.05
135 0.05
136 0.06
137 0.06
138 0.07
139 0.09
140 0.09
141 0.09
142 0.09
143 0.09
144 0.11
145 0.15
146 0.15
147 0.15
148 0.15
149 0.16
150 0.16
151 0.16
152 0.17
153 0.18
154 0.18
155 0.18
156 0.22
157 0.21
158 0.22
159 0.22
160 0.18
161 0.17
162 0.19
163 0.2
164 0.18
165 0.19
166 0.18
167 0.19
168 0.18
169 0.17
170 0.13
171 0.11
172 0.13
173 0.12
174 0.12
175 0.12
176 0.12
177 0.12
178 0.12
179 0.1
180 0.08
181 0.08
182 0.07
183 0.07
184 0.06
185 0.06
186 0.06
187 0.07
188 0.07
189 0.08
190 0.1
191 0.1
192 0.1
193 0.1
194 0.11
195 0.14
196 0.19
197 0.19
198 0.19
199 0.21
200 0.22
201 0.24
202 0.25
203 0.26
204 0.24
205 0.25
206 0.26
207 0.31
208 0.3
209 0.3
210 0.3
211 0.29
212 0.26
213 0.24
214 0.2
215 0.14
216 0.13
217 0.12
218 0.09
219 0.07
220 0.06
221 0.06
222 0.06
223 0.06
224 0.07
225 0.08
226 0.1
227 0.1
228 0.11
229 0.11
230 0.11
231 0.13
232 0.13
233 0.15
234 0.15
235 0.17
236 0.17
237 0.17
238 0.18
239 0.16
240 0.16
241 0.14
242 0.11
243 0.09
244 0.1
245 0.09
246 0.09
247 0.08
248 0.07
249 0.06
250 0.06
251 0.05
252 0.04
253 0.04
254 0.03
255 0.03
256 0.03
257 0.03
258 0.03
259 0.03
260 0.03
261 0.03
262 0.03
263 0.03
264 0.04
265 0.06
266 0.06
267 0.06
268 0.08
269 0.1
270 0.11
271 0.12
272 0.12
273 0.13
274 0.14
275 0.16
276 0.17
277 0.16
278 0.16
279 0.16
280 0.16
281 0.14
282 0.16
283 0.14
284 0.12
285 0.12
286 0.12
287 0.15
288 0.15
289 0.16
290 0.13
291 0.14
292 0.16
293 0.18
294 0.21
295 0.25
296 0.34
297 0.42
298 0.52
299 0.59
300 0.67
301 0.75
302 0.82
303 0.85
304 0.87
305 0.89
306 0.9
307 0.89
308 0.9
309 0.9
310 0.89
311 0.85
312 0.77
313 0.73
314 0.63
315 0.57
316 0.52
317 0.44
318 0.38
319 0.33
320 0.29
321 0.23
322 0.23
323 0.23
324 0.21
325 0.23
326 0.18
327 0.18
328 0.19
329 0.19
330 0.17
331 0.16
332 0.18
333 0.22
334 0.27
335 0.32
336 0.4
337 0.49
338 0.54
339 0.61
340 0.66
341 0.68
342 0.73
343 0.76
344 0.75
345 0.74
346 0.72
347 0.7