Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3N293

Protein Details
Accession A0A5C3N293   
Localization Confidence Medium
Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
121-155TEPRARSVKRRRVAKTRGKKRSTTKATNKQTKNEEHydrophilic
NLS Segment(s)
PositionSequence
70-71KR
123-144PRARSVKRRRVAKTRGKKRSTT
Subcellular Location(s) nucl 19.5, cyto_nucl 13.5, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MPSEFPWDTLKAETLRSLCRDLNLPPRLGRRAEMIKALSAIADEGLEVVLERIDEIVPNETGASSSRRAKRPREAEPQGTLLSDRKKGINLRSGLRADGSLLKKRQKAFDGVVIESAKAETEPRARSVKRRRVAKTRGKKRSTTKATNKQTKNEEEDGRRSDEDGDEDAAGSDTAAGPSTSNVSHVPVSFGEASP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.29
3 0.31
4 0.33
5 0.3
6 0.31
7 0.32
8 0.33
9 0.4
10 0.39
11 0.39
12 0.4
13 0.45
14 0.47
15 0.46
16 0.42
17 0.39
18 0.41
19 0.4
20 0.4
21 0.35
22 0.32
23 0.31
24 0.29
25 0.22
26 0.15
27 0.13
28 0.07
29 0.06
30 0.04
31 0.04
32 0.04
33 0.04
34 0.03
35 0.03
36 0.03
37 0.03
38 0.03
39 0.04
40 0.04
41 0.05
42 0.06
43 0.08
44 0.08
45 0.08
46 0.08
47 0.08
48 0.08
49 0.09
50 0.11
51 0.12
52 0.2
53 0.27
54 0.34
55 0.4
56 0.47
57 0.55
58 0.6
59 0.65
60 0.68
61 0.68
62 0.65
63 0.62
64 0.58
65 0.48
66 0.41
67 0.33
68 0.26
69 0.23
70 0.21
71 0.19
72 0.17
73 0.2
74 0.24
75 0.27
76 0.3
77 0.3
78 0.3
79 0.34
80 0.34
81 0.3
82 0.27
83 0.22
84 0.16
85 0.2
86 0.2
87 0.21
88 0.24
89 0.29
90 0.32
91 0.34
92 0.37
93 0.33
94 0.35
95 0.31
96 0.33
97 0.31
98 0.28
99 0.29
100 0.25
101 0.23
102 0.18
103 0.16
104 0.1
105 0.07
106 0.07
107 0.07
108 0.12
109 0.14
110 0.17
111 0.24
112 0.25
113 0.35
114 0.46
115 0.53
116 0.55
117 0.63
118 0.67
119 0.71
120 0.8
121 0.81
122 0.81
123 0.83
124 0.86
125 0.82
126 0.83
127 0.81
128 0.82
129 0.81
130 0.8
131 0.8
132 0.8
133 0.85
134 0.88
135 0.84
136 0.8
137 0.79
138 0.74
139 0.7
140 0.66
141 0.63
142 0.58
143 0.6
144 0.56
145 0.53
146 0.47
147 0.41
148 0.36
149 0.3
150 0.27
151 0.22
152 0.2
153 0.16
154 0.15
155 0.15
156 0.13
157 0.11
158 0.08
159 0.07
160 0.06
161 0.06
162 0.06
163 0.06
164 0.06
165 0.07
166 0.1
167 0.09
168 0.11
169 0.12
170 0.14
171 0.16
172 0.17
173 0.19
174 0.16
175 0.21