Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C3MW11

Protein Details
Accession A0A5C3MW11    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
87-113APSPAPSIPRKPKYRPRAPIRKPTTGGHydrophilic
NLS Segment(s)
PositionSequence
93-118SIPRKPKYRPRAPIRKPTTGGKPIKK
Subcellular Location(s) mito 16, nucl 8, cyto_nucl 6.5
Family & Domain DBs
Amino Acid Sequences MAAAPSSYGVSKPRSLIYPHPSSVMACQIISNPKTCQLSPSPVERRSVSTSGLAPAIAAETPEQRPECPWTETPITSSSPSSHPPIAPSPAPSIPRKPKYRPRAPIRKPTTGGKPIKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.3
3 0.37
4 0.41
5 0.43
6 0.42
7 0.41
8 0.39
9 0.36
10 0.34
11 0.31
12 0.23
13 0.17
14 0.16
15 0.17
16 0.23
17 0.24
18 0.24
19 0.2
20 0.24
21 0.27
22 0.27
23 0.28
24 0.25
25 0.3
26 0.3
27 0.39
28 0.4
29 0.4
30 0.43
31 0.39
32 0.4
33 0.39
34 0.38
35 0.3
36 0.24
37 0.23
38 0.21
39 0.2
40 0.15
41 0.09
42 0.08
43 0.07
44 0.05
45 0.05
46 0.04
47 0.06
48 0.07
49 0.1
50 0.1
51 0.1
52 0.12
53 0.16
54 0.18
55 0.2
56 0.21
57 0.23
58 0.25
59 0.26
60 0.26
61 0.24
62 0.23
63 0.21
64 0.21
65 0.18
66 0.18
67 0.2
68 0.22
69 0.22
70 0.2
71 0.22
72 0.25
73 0.27
74 0.26
75 0.26
76 0.27
77 0.29
78 0.32
79 0.33
80 0.39
81 0.45
82 0.54
83 0.59
84 0.64
85 0.71
86 0.77
87 0.84
88 0.85
89 0.86
90 0.88
91 0.89
92 0.9
93 0.88
94 0.87
95 0.8
96 0.77
97 0.76
98 0.75