Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C3N6H8

Protein Details
Accession A0A5C3N6H8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
33-54LPPMPPKKRLSNRVHQARHKPSHydrophilic
NLS Segment(s)
PositionSequence
37-53PPKKRLSNRVHQARHKP
Subcellular Location(s) extr 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR001338  Hydrophobin  
Gene Ontology GO:0005576  C:extracellular region  
GO:0009277  C:fungal-type cell wall  
GO:0005199  F:structural constituent of cell wall  
Pfam View protein in Pfam  
PF01185  Hydrophobin  
CDD cd23507  hydrophobin_I  
Amino Acid Sequences MKVTAVVAVLVACVLSVEALATPTNADRMARGLPPMPPKKRLSNRVHQARHKPSGAPPPPPTPTPTPPASGNSGSCNTGPVQCCNSVQKAGDGDMPGILGLLGLSASSADALVGTNCSPISALGLGGGASCDAHPVCCENNAQGGLISIGCIPITL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.03
4 0.03
5 0.03
6 0.05
7 0.05
8 0.05
9 0.06
10 0.07
11 0.09
12 0.09
13 0.09
14 0.09
15 0.11
16 0.14
17 0.14
18 0.15
19 0.16
20 0.2
21 0.3
22 0.39
23 0.41
24 0.46
25 0.49
26 0.58
27 0.65
28 0.71
29 0.69
30 0.7
31 0.76
32 0.8
33 0.84
34 0.81
35 0.82
36 0.8
37 0.78
38 0.69
39 0.6
40 0.55
41 0.58
42 0.54
43 0.5
44 0.46
45 0.45
46 0.46
47 0.45
48 0.43
49 0.38
50 0.37
51 0.35
52 0.33
53 0.3
54 0.29
55 0.3
56 0.3
57 0.25
58 0.23
59 0.21
60 0.21
61 0.19
62 0.17
63 0.16
64 0.13
65 0.15
66 0.15
67 0.15
68 0.16
69 0.16
70 0.17
71 0.18
72 0.19
73 0.17
74 0.17
75 0.16
76 0.15
77 0.15
78 0.15
79 0.13
80 0.12
81 0.1
82 0.09
83 0.07
84 0.06
85 0.05
86 0.03
87 0.02
88 0.02
89 0.02
90 0.02
91 0.02
92 0.02
93 0.02
94 0.02
95 0.02
96 0.02
97 0.03
98 0.03
99 0.03
100 0.05
101 0.05
102 0.06
103 0.06
104 0.06
105 0.06
106 0.06
107 0.08
108 0.07
109 0.07
110 0.06
111 0.06
112 0.06
113 0.06
114 0.06
115 0.04
116 0.04
117 0.04
118 0.06
119 0.06
120 0.07
121 0.08
122 0.11
123 0.12
124 0.14
125 0.16
126 0.15
127 0.2
128 0.21
129 0.2
130 0.18
131 0.17
132 0.15
133 0.14
134 0.13
135 0.08
136 0.07