Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3NC39

Protein Details
Accession A0A5C3NC39   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
27-55MQDRSARENRQQHKRQRRHPEIINPSKISHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, nucl 10
Family & Domain DBs
Amino Acid Sequences MILVQTLPQIQSVIKKQTSRLHHPPSMQDRSARENRQQHKRQRRHPEIINPSKISP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.32
3 0.37
4 0.43
5 0.5
6 0.53
7 0.57
8 0.57
9 0.57
10 0.57
11 0.6
12 0.6
13 0.58
14 0.5
15 0.44
16 0.39
17 0.42
18 0.48
19 0.44
20 0.43
21 0.47
22 0.54
23 0.62
24 0.69
25 0.72
26 0.76
27 0.83
28 0.85
29 0.87
30 0.89
31 0.87
32 0.86
33 0.86
34 0.86
35 0.86
36 0.84