Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3NGI1

Protein Details
Accession A0A5C3NGI1   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
59-78DFTAKSPGRGRPNQRRCYVCHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, extr 7
Family & Domain DBs
Amino Acid Sequences MFCKNLLYLVARQILAGPRVGARLPHPALSNIPRRMCKNGISEGGKGAFCAKWARSETDFTAKSPGRGRPNQRRCYVC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.22
3 0.21
4 0.16
5 0.13
6 0.15
7 0.15
8 0.14
9 0.13
10 0.2
11 0.21
12 0.22
13 0.23
14 0.22
15 0.26
16 0.31
17 0.37
18 0.34
19 0.37
20 0.38
21 0.39
22 0.43
23 0.41
24 0.4
25 0.35
26 0.33
27 0.35
28 0.34
29 0.32
30 0.28
31 0.28
32 0.23
33 0.19
34 0.17
35 0.11
36 0.1
37 0.13
38 0.13
39 0.17
40 0.2
41 0.24
42 0.25
43 0.29
44 0.31
45 0.37
46 0.37
47 0.32
48 0.38
49 0.34
50 0.36
51 0.38
52 0.42
53 0.42
54 0.51
55 0.6
56 0.63
57 0.73
58 0.79