Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3NA81

Protein Details
Accession A0A5C3NA81    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
75-96AVKIVHRVHRRSRSSRARQLLSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 9, cyto 6.5, cyto_nucl 4.5, plas 4, pero 4, extr 2
Family & Domain DBs
Amino Acid Sequences MDPRALPATFLYLDILLFHGTLLLAEMGSSERAQMCAHLDFVNFAAILPRKVTREQRLIVWLASERRVLALRLNAVKIVHRVHRRSRSSRARQLLSAHL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.08
4 0.08
5 0.07
6 0.06
7 0.05
8 0.05
9 0.06
10 0.04
11 0.04
12 0.04
13 0.04
14 0.05
15 0.06
16 0.06
17 0.06
18 0.06
19 0.07
20 0.08
21 0.08
22 0.1
23 0.1
24 0.11
25 0.11
26 0.11
27 0.1
28 0.11
29 0.1
30 0.08
31 0.07
32 0.09
33 0.09
34 0.09
35 0.1
36 0.11
37 0.12
38 0.17
39 0.23
40 0.26
41 0.31
42 0.32
43 0.33
44 0.35
45 0.34
46 0.3
47 0.25
48 0.21
49 0.17
50 0.17
51 0.16
52 0.13
53 0.13
54 0.14
55 0.13
56 0.14
57 0.16
58 0.19
59 0.21
60 0.22
61 0.22
62 0.21
63 0.23
64 0.24
65 0.25
66 0.28
67 0.34
68 0.41
69 0.49
70 0.59
71 0.66
72 0.69
73 0.75
74 0.78
75 0.8
76 0.84
77 0.83
78 0.78
79 0.73