Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3MK46

Protein Details
Accession A0A5C3MK46   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
53-73AASRGRSPEKRKEKEKVDWEIBasic
NLS Segment(s)
PositionSequence
56-67RGRSPEKRKEKE
Subcellular Location(s) plas 21, mito 2, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR037997  Dgk1-like  
Gene Ontology GO:0016020  C:membrane  
GO:0004143  F:diacylglycerol kinase activity  
Amino Acid Sequences MAIPASDAFSLAHDPRRRTARSPSPKIFASARGMPQPRRVNTNTRLKDVPEEAASRGRSPEKRKEKEKVDWEIPRKTLHSSIGFLTLYLWTSNGDPRTVVFACAAGLAALVPLDILRLRSPTFERLYEGAVGFLMRDVEKKATNGVIWYLIGVIFVLSLYPLDIAVVSILILSWADTAASTLGRLYGRHTPALPSLHFPFTTRPVFAQRKSLAGFLAASFTGFLCAIIFWIYVAPVRPAEESWTWEEGVIASGPSSEWVGRVKEMLGVMTGMDVSEIRWKASGAMGLGVIGVVAGVVSGVAEALDLGSLDDNLTLPILAGGCIYAFFVVLGWVAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.4
3 0.48
4 0.51
5 0.52
6 0.59
7 0.62
8 0.67
9 0.74
10 0.73
11 0.7
12 0.67
13 0.66
14 0.58
15 0.53
16 0.48
17 0.45
18 0.42
19 0.45
20 0.5
21 0.5
22 0.56
23 0.6
24 0.56
25 0.58
26 0.58
27 0.58
28 0.61
29 0.69
30 0.64
31 0.6
32 0.59
33 0.53
34 0.55
35 0.48
36 0.43
37 0.36
38 0.33
39 0.3
40 0.34
41 0.34
42 0.29
43 0.3
44 0.34
45 0.37
46 0.43
47 0.52
48 0.57
49 0.65
50 0.72
51 0.77
52 0.78
53 0.8
54 0.81
55 0.79
56 0.77
57 0.77
58 0.76
59 0.73
60 0.66
61 0.59
62 0.52
63 0.47
64 0.41
65 0.38
66 0.34
67 0.29
68 0.28
69 0.29
70 0.27
71 0.23
72 0.21
73 0.15
74 0.14
75 0.12
76 0.11
77 0.07
78 0.09
79 0.13
80 0.13
81 0.13
82 0.12
83 0.13
84 0.18
85 0.18
86 0.17
87 0.13
88 0.12
89 0.12
90 0.12
91 0.11
92 0.05
93 0.05
94 0.04
95 0.03
96 0.03
97 0.03
98 0.02
99 0.02
100 0.03
101 0.03
102 0.05
103 0.05
104 0.08
105 0.08
106 0.11
107 0.14
108 0.19
109 0.22
110 0.21
111 0.23
112 0.22
113 0.23
114 0.22
115 0.2
116 0.14
117 0.11
118 0.1
119 0.08
120 0.07
121 0.06
122 0.05
123 0.05
124 0.07
125 0.09
126 0.1
127 0.11
128 0.12
129 0.12
130 0.12
131 0.12
132 0.11
133 0.1
134 0.08
135 0.08
136 0.07
137 0.05
138 0.05
139 0.04
140 0.03
141 0.03
142 0.02
143 0.02
144 0.02
145 0.02
146 0.02
147 0.02
148 0.02
149 0.02
150 0.02
151 0.03
152 0.03
153 0.03
154 0.02
155 0.02
156 0.02
157 0.02
158 0.02
159 0.02
160 0.02
161 0.02
162 0.02
163 0.02
164 0.03
165 0.03
166 0.03
167 0.03
168 0.03
169 0.05
170 0.06
171 0.06
172 0.09
173 0.15
174 0.17
175 0.18
176 0.19
177 0.18
178 0.22
179 0.25
180 0.23
181 0.2
182 0.21
183 0.21
184 0.21
185 0.21
186 0.2
187 0.22
188 0.23
189 0.21
190 0.19
191 0.27
192 0.32
193 0.32
194 0.38
195 0.33
196 0.35
197 0.36
198 0.35
199 0.26
200 0.21
201 0.2
202 0.12
203 0.12
204 0.08
205 0.07
206 0.07
207 0.06
208 0.07
209 0.06
210 0.06
211 0.04
212 0.04
213 0.05
214 0.05
215 0.05
216 0.04
217 0.04
218 0.05
219 0.06
220 0.07
221 0.08
222 0.08
223 0.09
224 0.1
225 0.1
226 0.15
227 0.15
228 0.18
229 0.2
230 0.21
231 0.2
232 0.19
233 0.19
234 0.14
235 0.14
236 0.11
237 0.07
238 0.05
239 0.05
240 0.05
241 0.06
242 0.07
243 0.06
244 0.07
245 0.1
246 0.12
247 0.12
248 0.13
249 0.13
250 0.14
251 0.15
252 0.14
253 0.11
254 0.09
255 0.09
256 0.08
257 0.08
258 0.05
259 0.05
260 0.04
261 0.05
262 0.12
263 0.12
264 0.13
265 0.14
266 0.14
267 0.15
268 0.17
269 0.19
270 0.12
271 0.13
272 0.12
273 0.11
274 0.11
275 0.09
276 0.07
277 0.04
278 0.03
279 0.02
280 0.02
281 0.02
282 0.01
283 0.02
284 0.02
285 0.02
286 0.02
287 0.02
288 0.02
289 0.02
290 0.02
291 0.03
292 0.03
293 0.04
294 0.04
295 0.04
296 0.05
297 0.05
298 0.06
299 0.06
300 0.06
301 0.06
302 0.05
303 0.06
304 0.07
305 0.06
306 0.06
307 0.06
308 0.06
309 0.06
310 0.06
311 0.05
312 0.05
313 0.05
314 0.05
315 0.05