Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3N1D6

Protein Details
Accession A0A5C3N1D6    Localization Confidence High Confidence Score 18.8
NoLS Segment(s)
PositionSequenceProtein Nature
10-33ESTPRPPATPHKRAVKRRSMDTPCHydrophilic
NLS Segment(s)
PositionSequence
108-132PKRHVKRNAAAGSKRASRRVRGKVR
146-159HKPSAKVQGKRKAS
Subcellular Location(s) nucl 22, cyto 3
Family & Domain DBs
Amino Acid Sequences QEKEKRFTEESTPRPPATPHKRAVKRRSMDTPCSTPGTASMASTPSPSKPAKSSELAPGNSRSSGFHAIATTQGRGRKKLRIQPVQRSEYDEILDPVEYAKKLEGMLPKRHVKRNAAAGSKRASRRVRGKVRDEETSSEDEPVQKHKPSAKVQGKRKASGTKVKGESIDIEPEDAEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.54
3 0.55
4 0.55
5 0.57
6 0.55
7 0.6
8 0.69
9 0.78
10 0.84
11 0.84
12 0.8
13 0.79
14 0.81
15 0.78
16 0.76
17 0.73
18 0.68
19 0.61
20 0.59
21 0.51
22 0.41
23 0.34
24 0.3
25 0.24
26 0.19
27 0.17
28 0.14
29 0.14
30 0.16
31 0.16
32 0.12
33 0.17
34 0.18
35 0.19
36 0.21
37 0.26
38 0.29
39 0.3
40 0.32
41 0.35
42 0.41
43 0.39
44 0.39
45 0.37
46 0.34
47 0.31
48 0.29
49 0.22
50 0.19
51 0.22
52 0.2
53 0.17
54 0.16
55 0.15
56 0.18
57 0.19
58 0.16
59 0.14
60 0.19
61 0.19
62 0.24
63 0.27
64 0.32
65 0.37
66 0.44
67 0.51
68 0.57
69 0.62
70 0.67
71 0.73
72 0.69
73 0.62
74 0.6
75 0.51
76 0.42
77 0.36
78 0.26
79 0.18
80 0.15
81 0.14
82 0.08
83 0.07
84 0.08
85 0.07
86 0.07
87 0.06
88 0.07
89 0.07
90 0.1
91 0.17
92 0.21
93 0.28
94 0.34
95 0.42
96 0.47
97 0.53
98 0.55
99 0.53
100 0.53
101 0.57
102 0.57
103 0.57
104 0.53
105 0.5
106 0.5
107 0.52
108 0.49
109 0.48
110 0.44
111 0.45
112 0.53
113 0.6
114 0.65
115 0.67
116 0.72
117 0.73
118 0.74
119 0.72
120 0.66
121 0.59
122 0.52
123 0.49
124 0.41
125 0.33
126 0.3
127 0.25
128 0.24
129 0.26
130 0.27
131 0.24
132 0.28
133 0.33
134 0.41
135 0.45
136 0.55
137 0.59
138 0.64
139 0.72
140 0.77
141 0.78
142 0.74
143 0.74
144 0.72
145 0.69
146 0.7
147 0.66
148 0.66
149 0.63
150 0.62
151 0.56
152 0.49
153 0.46
154 0.39
155 0.39
156 0.3
157 0.27