Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3MQV7

Protein Details
Accession A0A5C3MQV7   
Localization Confidence Medium
Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
119-144KETAKDKRGGKGRKGKKGKKAARSSLBasic
NLS Segment(s)
PositionSequence
121-142TAKDKRGGKGRKGKKGKKAARS
Subcellular Location(s) nucl 8.5, cyto_nucl 7, mito 5, cyto 4.5, extr 3, plas 2, E.R. 2
Family & Domain DBs
Amino Acid Sequences MSAARYQTVPTDDHEAKFAASDASPEALHAKLQQDPRFNQPAPAPWKRALLLLFLLALLYLGLHLRLQSPAETKVVHAQRYSKDYKFRPAASPVVTEKLKDGRVRVRGAQPTYAAAPVKETAKDKRGGKGRKGKKGKKAARSSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.26
3 0.23
4 0.22
5 0.2
6 0.13
7 0.1
8 0.11
9 0.1
10 0.11
11 0.11
12 0.11
13 0.12
14 0.11
15 0.12
16 0.13
17 0.14
18 0.17
19 0.25
20 0.29
21 0.34
22 0.36
23 0.43
24 0.48
25 0.46
26 0.44
27 0.39
28 0.42
29 0.44
30 0.47
31 0.44
32 0.38
33 0.41
34 0.38
35 0.38
36 0.31
37 0.24
38 0.2
39 0.16
40 0.13
41 0.1
42 0.1
43 0.06
44 0.06
45 0.03
46 0.03
47 0.02
48 0.02
49 0.03
50 0.03
51 0.03
52 0.04
53 0.05
54 0.06
55 0.07
56 0.09
57 0.1
58 0.11
59 0.11
60 0.11
61 0.18
62 0.2
63 0.2
64 0.2
65 0.22
66 0.23
67 0.29
68 0.33
69 0.29
70 0.34
71 0.35
72 0.43
73 0.44
74 0.44
75 0.42
76 0.41
77 0.42
78 0.36
79 0.37
80 0.31
81 0.31
82 0.28
83 0.25
84 0.23
85 0.24
86 0.26
87 0.24
88 0.27
89 0.29
90 0.35
91 0.38
92 0.41
93 0.44
94 0.47
95 0.48
96 0.46
97 0.39
98 0.36
99 0.34
100 0.32
101 0.25
102 0.17
103 0.18
104 0.17
105 0.18
106 0.2
107 0.22
108 0.26
109 0.31
110 0.38
111 0.39
112 0.45
113 0.53
114 0.58
115 0.64
116 0.69
117 0.73
118 0.77
119 0.85
120 0.86
121 0.87
122 0.9
123 0.89
124 0.89