Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3NHQ3

Protein Details
Accession A0A5C3NHQ3   
Localization Confidence Medium
Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-46MVVKVPIVKKRTKPFKRHQSDRYKSVKENWRKPKGIDNRVRRRFKGBasic
NLS Segment(s)
PositionSequence
9-52KKRTKPFKRHQSDRYKSVKENWRKPKGIDNRVRRRFKGQLPMPK
Subcellular Location(s) mito 15.5, mito_nucl 13.833, nucl 11, cyto_nucl 6.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVVKVPIVKKRTKPFKRHQSDRYKSVKENWRKPKGIDNRVRRRFKGQLPMPKIGYGSNKKTRHLLPNGLKKFLVSNVRELDILLMHNKSFAAEIAHNVSSRNRALILERAKVLSVKVTNPAARLRSEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.88
3 0.9
4 0.91
5 0.91
6 0.91
7 0.89
8 0.88
9 0.86
10 0.81
11 0.74
12 0.73
13 0.73
14 0.72
15 0.74
16 0.75
17 0.76
18 0.73
19 0.71
20 0.72
21 0.72
22 0.72
23 0.72
24 0.72
25 0.73
26 0.81
27 0.85
28 0.77
29 0.74
30 0.71
31 0.67
32 0.67
33 0.64
34 0.64
35 0.63
36 0.65
37 0.59
38 0.52
39 0.46
40 0.37
41 0.37
42 0.33
43 0.35
44 0.4
45 0.41
46 0.42
47 0.45
48 0.47
49 0.47
50 0.45
51 0.47
52 0.45
53 0.53
54 0.54
55 0.52
56 0.47
57 0.4
58 0.36
59 0.32
60 0.31
61 0.22
62 0.25
63 0.25
64 0.26
65 0.25
66 0.24
67 0.2
68 0.13
69 0.13
70 0.1
71 0.09
72 0.08
73 0.08
74 0.08
75 0.08
76 0.08
77 0.07
78 0.09
79 0.09
80 0.11
81 0.15
82 0.16
83 0.16
84 0.17
85 0.18
86 0.19
87 0.19
88 0.18
89 0.15
90 0.15
91 0.18
92 0.25
93 0.29
94 0.28
95 0.29
96 0.29
97 0.29
98 0.28
99 0.26
100 0.25
101 0.22
102 0.2
103 0.25
104 0.29
105 0.31
106 0.33
107 0.38
108 0.34