Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3N2R0

Protein Details
Accession A0A5C3N2R0   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
41-65IASRIAEKKARKRRRLEEPDASHVQHydrophilic
NLS Segment(s)
PositionSequence
43-55SRIAEKKARKRRR
Subcellular Location(s) mito 16, nucl 10.5, cyto_nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR013087  Znf_C2H2_type  
PROSITE View protein in PROSITE  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MPSIFTCVPSCGKSYGKQVTLTLHQRSCDEYKRPNPKLANIASRIAEKKARKRRRLEEPDASHVQLISV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.39
3 0.38
4 0.39
5 0.38
6 0.38
7 0.42
8 0.44
9 0.41
10 0.36
11 0.34
12 0.33
13 0.35
14 0.36
15 0.34
16 0.33
17 0.35
18 0.43
19 0.52
20 0.54
21 0.56
22 0.54
23 0.51
24 0.54
25 0.5
26 0.47
27 0.39
28 0.39
29 0.33
30 0.35
31 0.33
32 0.28
33 0.31
34 0.32
35 0.4
36 0.49
37 0.59
38 0.64
39 0.73
40 0.79
41 0.83
42 0.87
43 0.85
44 0.85
45 0.81
46 0.8
47 0.75
48 0.67
49 0.56