Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3NGR9

Protein Details
Accession A0A5C3NGR9    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MAKSLRSKTKRAFRSKKREVGVYHydrophilic
NLS Segment(s)
PositionSequence
7-18SKTKRAFRSKKR
Subcellular Location(s) mito 15.5, cyto_mito 11.5, cyto 6.5, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKSLRSKTKRAFRSKKREVGVYAATEAARLNRLNQKLVALKAADPADFREVSEGEGEGEKEGWTDEDKIIAGWCCFPFFGLCDQDCVTPETMQEWAGLAAWGEAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.9
3 0.89
4 0.84
5 0.79
6 0.71
7 0.66
8 0.59
9 0.5
10 0.41
11 0.33
12 0.28
13 0.23
14 0.2
15 0.14
16 0.13
17 0.11
18 0.14
19 0.2
20 0.22
21 0.24
22 0.24
23 0.27
24 0.27
25 0.28
26 0.26
27 0.2
28 0.18
29 0.2
30 0.2
31 0.16
32 0.13
33 0.14
34 0.15
35 0.14
36 0.13
37 0.11
38 0.1
39 0.11
40 0.1
41 0.09
42 0.07
43 0.07
44 0.07
45 0.06
46 0.06
47 0.05
48 0.05
49 0.05
50 0.05
51 0.06
52 0.08
53 0.08
54 0.08
55 0.08
56 0.09
57 0.1
58 0.1
59 0.09
60 0.1
61 0.11
62 0.11
63 0.1
64 0.11
65 0.1
66 0.11
67 0.15
68 0.17
69 0.17
70 0.2
71 0.21
72 0.22
73 0.22
74 0.23
75 0.2
76 0.16
77 0.16
78 0.14
79 0.14
80 0.14
81 0.13
82 0.11
83 0.09
84 0.09
85 0.09
86 0.07