Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3MLV9

Protein Details
Accession A0A5C3MLV9   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
8-28SSLPRAPQKLQYKFPKPPLQLHydrophilic
49-82RITPSDPYKTCKKCRDKEKEKRKRRAERDAAAASBasic
NLS Segment(s)
PositionSequence
63-79RDKEKEKRKRRAERDAA
Subcellular Location(s) nucl 14, mito_nucl 11.333, cyto_nucl 10.333, mito 7.5, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MDLPPKSSSLPRAPQKLQYKFPKPPLQLPTATASQPAAMKVCSGCHKPRITPSDPYKTCKKCRDKEKEKRKRRAERDAAAASLVPNRKPAPTPPTGIGRKPLLEVRDLSRAGLADFGKVKGEMVVKREETKKVVVGVKREAGADDGLPRFMKRPKLEPHARVPFHAPPLDDFAPTSYQSSTSLIHAIPSLRSVAFTGVYSIVANPTTSHSRRVHKVYKELKRELKPSWTFGASSTVIDSNPYIHRAQFPCTCTAAVPTRPQPSKPKNLMGYFSSSPSPLEDNDAGKCAGYLRITVSDDDSHWLPIKGQKVVVQVEHP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.73
3 0.74
4 0.74
5 0.75
6 0.76
7 0.76
8 0.82
9 0.82
10 0.77
11 0.78
12 0.74
13 0.7
14 0.64
15 0.57
16 0.53
17 0.46
18 0.41
19 0.34
20 0.27
21 0.23
22 0.22
23 0.2
24 0.17
25 0.14
26 0.15
27 0.15
28 0.19
29 0.22
30 0.27
31 0.31
32 0.38
33 0.42
34 0.45
35 0.54
36 0.58
37 0.56
38 0.6
39 0.63
40 0.66
41 0.65
42 0.66
43 0.67
44 0.67
45 0.72
46 0.73
47 0.75
48 0.73
49 0.8
50 0.87
51 0.88
52 0.9
53 0.92
54 0.93
55 0.93
56 0.95
57 0.95
58 0.94
59 0.92
60 0.92
61 0.91
62 0.86
63 0.83
64 0.75
65 0.64
66 0.53
67 0.44
68 0.33
69 0.29
70 0.26
71 0.17
72 0.19
73 0.19
74 0.21
75 0.23
76 0.28
77 0.29
78 0.31
79 0.34
80 0.33
81 0.41
82 0.43
83 0.42
84 0.41
85 0.36
86 0.33
87 0.32
88 0.32
89 0.24
90 0.23
91 0.24
92 0.22
93 0.26
94 0.25
95 0.23
96 0.21
97 0.2
98 0.17
99 0.19
100 0.16
101 0.11
102 0.12
103 0.13
104 0.12
105 0.12
106 0.12
107 0.11
108 0.15
109 0.15
110 0.16
111 0.21
112 0.21
113 0.26
114 0.29
115 0.28
116 0.27
117 0.27
118 0.26
119 0.26
120 0.3
121 0.28
122 0.28
123 0.29
124 0.28
125 0.27
126 0.25
127 0.21
128 0.17
129 0.15
130 0.11
131 0.11
132 0.1
133 0.1
134 0.1
135 0.1
136 0.12
137 0.15
138 0.22
139 0.21
140 0.28
141 0.34
142 0.43
143 0.51
144 0.52
145 0.58
146 0.6
147 0.58
148 0.52
149 0.5
150 0.43
151 0.39
152 0.36
153 0.27
154 0.19
155 0.25
156 0.24
157 0.2
158 0.17
159 0.15
160 0.15
161 0.16
162 0.16
163 0.1
164 0.1
165 0.11
166 0.12
167 0.12
168 0.1
169 0.12
170 0.1
171 0.11
172 0.11
173 0.11
174 0.09
175 0.09
176 0.09
177 0.08
178 0.08
179 0.08
180 0.08
181 0.08
182 0.08
183 0.08
184 0.08
185 0.08
186 0.08
187 0.07
188 0.07
189 0.07
190 0.07
191 0.06
192 0.09
193 0.16
194 0.17
195 0.24
196 0.29
197 0.34
198 0.4
199 0.48
200 0.53
201 0.51
202 0.61
203 0.64
204 0.68
205 0.71
206 0.73
207 0.73
208 0.71
209 0.7
210 0.63
211 0.63
212 0.57
213 0.52
214 0.48
215 0.41
216 0.35
217 0.31
218 0.33
219 0.24
220 0.21
221 0.19
222 0.16
223 0.15
224 0.15
225 0.14
226 0.12
227 0.13
228 0.16
229 0.15
230 0.15
231 0.23
232 0.24
233 0.29
234 0.32
235 0.33
236 0.33
237 0.34
238 0.33
239 0.27
240 0.3
241 0.3
242 0.29
243 0.33
244 0.36
245 0.43
246 0.45
247 0.5
248 0.55
249 0.58
250 0.64
251 0.65
252 0.67
253 0.66
254 0.67
255 0.67
256 0.59
257 0.57
258 0.48
259 0.43
260 0.36
261 0.28
262 0.25
263 0.23
264 0.22
265 0.16
266 0.21
267 0.21
268 0.22
269 0.23
270 0.25
271 0.23
272 0.2
273 0.2
274 0.15
275 0.16
276 0.14
277 0.14
278 0.15
279 0.19
280 0.21
281 0.22
282 0.24
283 0.23
284 0.23
285 0.26
286 0.23
287 0.22
288 0.22
289 0.22
290 0.21
291 0.25
292 0.3
293 0.29
294 0.3
295 0.32
296 0.36
297 0.39