Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2LXR8

Protein Details
Accession E2LXR8    Localization Confidence Low Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MRRRGNKSTKVPNVKLRPAQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, cyto 6, nucl 3, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001357  BRCT_dom  
IPR036420  BRCT_dom_sf  
KEGG mpr:MPER_12086  -  
Pfam View protein in Pfam  
PF12738  PTCB-BRCT  
PROSITE View protein in PROSITE  
PS50172  BRCT  
Amino Acid Sequences MRRRGNKSTKVPNVKLRPAQPQPSSSKPRTQEADFSEGDDIWAQDSQLKEDDICPRPFYGFMLCATGVMDKPGLFRQAVELGAATCNAFTDRVTHLIAVDHGGPKYMCALERKIPILKPEWISENYQIWLRRDDVDIAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.8
3 0.74
4 0.73
5 0.71
6 0.73
7 0.67
8 0.65
9 0.63
10 0.65
11 0.68
12 0.62
13 0.62
14 0.57
15 0.6
16 0.58
17 0.54
18 0.51
19 0.47
20 0.49
21 0.41
22 0.38
23 0.32
24 0.27
25 0.24
26 0.18
27 0.13
28 0.08
29 0.08
30 0.07
31 0.08
32 0.09
33 0.1
34 0.11
35 0.11
36 0.1
37 0.13
38 0.21
39 0.24
40 0.25
41 0.24
42 0.23
43 0.24
44 0.24
45 0.22
46 0.16
47 0.12
48 0.11
49 0.12
50 0.12
51 0.11
52 0.11
53 0.1
54 0.08
55 0.07
56 0.07
57 0.05
58 0.07
59 0.08
60 0.09
61 0.08
62 0.08
63 0.1
64 0.11
65 0.11
66 0.1
67 0.09
68 0.08
69 0.08
70 0.08
71 0.06
72 0.04
73 0.04
74 0.05
75 0.05
76 0.05
77 0.07
78 0.09
79 0.12
80 0.12
81 0.12
82 0.12
83 0.12
84 0.13
85 0.11
86 0.11
87 0.11
88 0.1
89 0.11
90 0.11
91 0.11
92 0.13
93 0.13
94 0.13
95 0.15
96 0.19
97 0.24
98 0.28
99 0.32
100 0.34
101 0.35
102 0.36
103 0.38
104 0.39
105 0.36
106 0.35
107 0.36
108 0.35
109 0.37
110 0.37
111 0.36
112 0.32
113 0.34
114 0.35
115 0.33
116 0.34
117 0.32
118 0.3
119 0.29