Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C3NR84

Protein Details
Accession A0A5C3NR84    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
11-37SSGGGKAAKKKKWSKGKVKDKAQHAVAHydrophilic
NLS Segment(s)
PositionSequence
12-31SGGGKAAKKKKWSKGKVKDK
Subcellular Location(s) nucl 14.5, cyto_nucl 11, cyto 6.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAKAKAAAPTSSGGGKAAKKKKWSKGKVKDKAQHAVALDKPTFDRIMKEVPTFRFISQSILIERLRVNGSLARRAIRHLEKEGLIKRIVHHSGQLIYTRITTGSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.23
3 0.31
4 0.38
5 0.41
6 0.5
7 0.59
8 0.68
9 0.74
10 0.8
11 0.81
12 0.84
13 0.89
14 0.9
15 0.91
16 0.88
17 0.83
18 0.8
19 0.71
20 0.63
21 0.53
22 0.47
23 0.39
24 0.36
25 0.3
26 0.23
27 0.22
28 0.2
29 0.2
30 0.16
31 0.15
32 0.12
33 0.17
34 0.18
35 0.2
36 0.22
37 0.22
38 0.25
39 0.25
40 0.23
41 0.21
42 0.19
43 0.21
44 0.18
45 0.18
46 0.15
47 0.17
48 0.17
49 0.16
50 0.16
51 0.15
52 0.14
53 0.13
54 0.13
55 0.13
56 0.16
57 0.2
58 0.21
59 0.21
60 0.21
61 0.23
62 0.29
63 0.32
64 0.34
65 0.32
66 0.35
67 0.35
68 0.42
69 0.44
70 0.39
71 0.35
72 0.32
73 0.3
74 0.35
75 0.36
76 0.29
77 0.28
78 0.28
79 0.29
80 0.3
81 0.31
82 0.25
83 0.23
84 0.22
85 0.2