Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C3N0K6

Protein Details
Accession A0A5C3N0K6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
4-25ASSGRAHKTRSWRRSRGSSFRPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24, cyto 2
Family & Domain DBs
Amino Acid Sequences MILASSGRAHKTRSWRRSRGSSFRPVGAVSGELEEASRLTLCSISGTISGTVQDTSGTWEWRREVAPATCKGHRTI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.67
3 0.73
4 0.8
5 0.84
6 0.83
7 0.79
8 0.78
9 0.71
10 0.64
11 0.57
12 0.47
13 0.38
14 0.29
15 0.22
16 0.13
17 0.1
18 0.08
19 0.07
20 0.07
21 0.06
22 0.05
23 0.05
24 0.04
25 0.04
26 0.04
27 0.04
28 0.04
29 0.05
30 0.05
31 0.05
32 0.06
33 0.07
34 0.07
35 0.07
36 0.07
37 0.07
38 0.07
39 0.07
40 0.06
41 0.06
42 0.1
43 0.13
44 0.15
45 0.16
46 0.19
47 0.2
48 0.23
49 0.24
50 0.21
51 0.25
52 0.29
53 0.35
54 0.39
55 0.44
56 0.45