Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C3MTH4

Protein Details
Accession A0A5C3MTH4    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
35-54GGPRTQPKKSKKSSARTRLVHydrophilic
NLS Segment(s)
PositionSequence
36-81GPRTQPKKSKKSSARTRLVQDLNPRGRPGSFSRGKLEIAPRAGKRK
Subcellular Location(s) mito 20, nucl 5.5, cyto_nucl 3.5
Family & Domain DBs
PROSITE View protein in PROSITE  
PS51257  PROKAR_LIPOPROTEIN  
Amino Acid Sequences MSALLRSLSLTPTRPTLCWNISCSCFHSSSTLQKGGPRTQPKKSKKSSARTRLVQDLNPRGRPGSFSRGKLEIAPRAGKRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.29
3 0.32
4 0.33
5 0.34
6 0.36
7 0.33
8 0.34
9 0.35
10 0.35
11 0.31
12 0.28
13 0.25
14 0.25
15 0.24
16 0.29
17 0.32
18 0.31
19 0.29
20 0.3
21 0.34
22 0.35
23 0.4
24 0.43
25 0.42
26 0.48
27 0.58
28 0.63
29 0.69
30 0.7
31 0.72
32 0.71
33 0.77
34 0.8
35 0.8
36 0.8
37 0.76
38 0.74
39 0.72
40 0.66
41 0.59
42 0.57
43 0.56
44 0.54
45 0.51
46 0.48
47 0.4
48 0.38
49 0.38
50 0.36
51 0.36
52 0.36
53 0.37
54 0.41
55 0.42
56 0.43
57 0.44
58 0.45
59 0.42
60 0.41
61 0.46