Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C3MNJ6

Protein Details
Accession A0A5C3MNJ6    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
6-28TDAIRAASLKRRKKPAKFHCTYPHydrophilic
NLS Segment(s)
PositionSequence
15-20KRRKKP
Subcellular Location(s) nucl 13.5, mito 13, cyto_nucl 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Pfam View protein in Pfam  
PF00096  zf-C2H2  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences KSTVTTDAIRAASLKRRKKPAKFHCTYPGCGSGFTRANNLHGHIRSHTGERPYTCMVVGCSSAFARENDLKRHMPTH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.46
3 0.57
4 0.66
5 0.74
6 0.82
7 0.84
8 0.86
9 0.81
10 0.79
11 0.79
12 0.73
13 0.67
14 0.59
15 0.54
16 0.43
17 0.39
18 0.33
19 0.28
20 0.26
21 0.24
22 0.24
23 0.18
24 0.2
25 0.2
26 0.21
27 0.21
28 0.19
29 0.2
30 0.18
31 0.21
32 0.2
33 0.23
34 0.24
35 0.23
36 0.25
37 0.25
38 0.29
39 0.27
40 0.26
41 0.23
42 0.21
43 0.19
44 0.17
45 0.17
46 0.12
47 0.12
48 0.12
49 0.13
50 0.14
51 0.13
52 0.18
53 0.24
54 0.29
55 0.33
56 0.39
57 0.41