Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C3MNV5

Protein Details
Accession A0A5C3MNV5    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
1-23SAAVRRRARRTPRRPYCNGPTMVHydrophilic
NLS Segment(s)
PositionSequence
8-9AR
Subcellular Location(s) mito 21, nucl 3, cyto 3, cyto_nucl 3
Family & Domain DBs
Amino Acid Sequences SAAVRRRARRTPRRPYCNGPTMVGESPTFSDAHHQIRWRPVFFASQSPGTLPFSESVHSVLDQLCSSIEFAEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.86
3 0.84
4 0.81
5 0.73
6 0.64
7 0.55
8 0.5
9 0.44
10 0.37
11 0.27
12 0.19
13 0.18
14 0.17
15 0.14
16 0.09
17 0.12
18 0.14
19 0.18
20 0.2
21 0.2
22 0.22
23 0.3
24 0.33
25 0.3
26 0.28
27 0.25
28 0.26
29 0.26
30 0.28
31 0.23
32 0.21
33 0.21
34 0.2
35 0.21
36 0.19
37 0.18
38 0.15
39 0.13
40 0.12
41 0.13
42 0.13
43 0.12
44 0.12
45 0.12
46 0.12
47 0.11
48 0.13
49 0.12
50 0.12
51 0.11
52 0.1
53 0.1