Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3N6A9

Protein Details
Accession A0A5C3N6A9    Localization Confidence Low Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
5-33GFWSSCKQVHENKKTSRRIRKECTIEMRVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, nucl 11.5, cyto_nucl 6.5
Family & Domain DBs
Amino Acid Sequences MSHSGFWSSCKQVHENKKTSRRIRKECTIEMRVLEKEIKTVDSVLIKPYADLVITVMDIKIRAHEWTREMTLLRYLERDNISAELAQLESKLAKAHETWRQATVQLSEQLALGIAPPVDPFQEAVRHCIAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.63
3 0.69
4 0.75
5 0.81
6 0.86
7 0.88
8 0.87
9 0.87
10 0.87
11 0.86
12 0.85
13 0.83
14 0.81
15 0.74
16 0.65
17 0.58
18 0.53
19 0.43
20 0.37
21 0.31
22 0.22
23 0.2
24 0.19
25 0.18
26 0.15
27 0.14
28 0.14
29 0.14
30 0.15
31 0.14
32 0.15
33 0.14
34 0.13
35 0.13
36 0.11
37 0.08
38 0.08
39 0.06
40 0.05
41 0.05
42 0.06
43 0.05
44 0.05
45 0.05
46 0.05
47 0.06
48 0.06
49 0.07
50 0.09
51 0.1
52 0.12
53 0.14
54 0.15
55 0.15
56 0.15
57 0.14
58 0.16
59 0.15
60 0.14
61 0.14
62 0.13
63 0.16
64 0.17
65 0.17
66 0.14
67 0.14
68 0.14
69 0.13
70 0.12
71 0.09
72 0.08
73 0.07
74 0.06
75 0.06
76 0.05
77 0.06
78 0.07
79 0.07
80 0.08
81 0.1
82 0.16
83 0.22
84 0.28
85 0.29
86 0.31
87 0.31
88 0.31
89 0.32
90 0.29
91 0.25
92 0.23
93 0.22
94 0.2
95 0.19
96 0.17
97 0.15
98 0.12
99 0.08
100 0.06
101 0.05
102 0.05
103 0.06
104 0.07
105 0.08
106 0.08
107 0.09
108 0.11
109 0.18
110 0.19
111 0.23