Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3NT74

Protein Details
Accession A0A5C3NT74    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
228-258KLTEEQKKRNSTPSPKQRRPPIKRTSSTFADHydrophilic
NLS Segment(s)
PositionSequence
83-98RSTDRERPRGRSRDRK
234-250KKRNSTPSPKQRRPPIK
Subcellular Location(s) mito 11, nucl 9.5, cyto_nucl 7.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MSPRPILKRDPPSAIPSNPLPFAACPTLFSPKVRFPPTPVLTSTHPTHSPSTYDRAPIVVSPNACALPRRGEREVQFGERPGRSTDRERPRGRSRDRKAVSVKGSYFHPRAYEACEAEPPAGHTGAVDADHDIPSLPPLPAAIPLPPPLVHDISSSESDESDVTTPPDVHFQEPPSLSLSSASTCKPQHPDSHYLPPLNATFASQAEMNSALAFLPHPPSPIRERTPKLTEEQKKRNSTPSPKQRRPPIKRTSSTFADPPLDACLGGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.53
3 0.49
4 0.47
5 0.41
6 0.37
7 0.31
8 0.25
9 0.28
10 0.28
11 0.23
12 0.21
13 0.23
14 0.3
15 0.3
16 0.33
17 0.33
18 0.36
19 0.45
20 0.48
21 0.46
22 0.45
23 0.54
24 0.55
25 0.53
26 0.47
27 0.43
28 0.41
29 0.44
30 0.41
31 0.35
32 0.34
33 0.33
34 0.34
35 0.31
36 0.32
37 0.3
38 0.34
39 0.31
40 0.31
41 0.28
42 0.26
43 0.25
44 0.23
45 0.24
46 0.21
47 0.19
48 0.17
49 0.19
50 0.19
51 0.18
52 0.18
53 0.16
54 0.22
55 0.26
56 0.31
57 0.32
58 0.37
59 0.38
60 0.45
61 0.47
62 0.43
63 0.39
64 0.36
65 0.39
66 0.34
67 0.34
68 0.29
69 0.3
70 0.29
71 0.34
72 0.41
73 0.46
74 0.55
75 0.57
76 0.62
77 0.68
78 0.74
79 0.77
80 0.78
81 0.74
82 0.75
83 0.74
84 0.73
85 0.69
86 0.66
87 0.61
88 0.55
89 0.49
90 0.39
91 0.4
92 0.38
93 0.34
94 0.28
95 0.24
96 0.2
97 0.21
98 0.24
99 0.24
100 0.2
101 0.19
102 0.19
103 0.18
104 0.17
105 0.16
106 0.12
107 0.1
108 0.09
109 0.08
110 0.07
111 0.07
112 0.07
113 0.07
114 0.06
115 0.05
116 0.06
117 0.06
118 0.06
119 0.06
120 0.05
121 0.06
122 0.07
123 0.06
124 0.05
125 0.05
126 0.05
127 0.06
128 0.07
129 0.07
130 0.08
131 0.09
132 0.1
133 0.1
134 0.11
135 0.13
136 0.13
137 0.13
138 0.12
139 0.13
140 0.14
141 0.15
142 0.15
143 0.13
144 0.11
145 0.11
146 0.11
147 0.1
148 0.08
149 0.07
150 0.08
151 0.08
152 0.09
153 0.09
154 0.14
155 0.14
156 0.15
157 0.16
158 0.17
159 0.22
160 0.22
161 0.22
162 0.2
163 0.19
164 0.17
165 0.16
166 0.16
167 0.12
168 0.13
169 0.13
170 0.16
171 0.16
172 0.2
173 0.24
174 0.27
175 0.33
176 0.37
177 0.44
178 0.44
179 0.53
180 0.54
181 0.49
182 0.46
183 0.41
184 0.36
185 0.3
186 0.24
187 0.16
188 0.13
189 0.13
190 0.14
191 0.11
192 0.11
193 0.1
194 0.11
195 0.1
196 0.08
197 0.08
198 0.07
199 0.06
200 0.07
201 0.07
202 0.09
203 0.1
204 0.12
205 0.13
206 0.17
207 0.23
208 0.31
209 0.36
210 0.42
211 0.47
212 0.53
213 0.58
214 0.57
215 0.57
216 0.6
217 0.63
218 0.64
219 0.69
220 0.71
221 0.74
222 0.75
223 0.78
224 0.77
225 0.78
226 0.78
227 0.79
228 0.81
229 0.81
230 0.87
231 0.89
232 0.91
233 0.9
234 0.89
235 0.89
236 0.88
237 0.87
238 0.85
239 0.82
240 0.77
241 0.72
242 0.65
243 0.59
244 0.52
245 0.44
246 0.38
247 0.34
248 0.28