Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C3NFF8

Protein Details
Accession A0A5C3NFF8    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
81-120PLDLRPKRTRAIRRRLTKHEKSLKTEKQRKKDIHFPIRKYBasic
NLS Segment(s)
PositionSequence
84-119LRPKRTRAIRRRLTKHEKSLKTEKQRKKDIHFPIRK
Subcellular Location(s) nucl 21.5, cyto_nucl 14, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR018254  Ribosomal_L29_CS  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
PROSITE View protein in PROSITE  
PS00579  RIBOSOMAL_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MPGKVKAYELQSKSKNDLSKQLVDLKNELLTLRVQKVVGGSASKLTKINSVRKSIARVLTVMNQKQRQNLREFYKNKKYLPLDLRPKRTRAIRRRLTKHEKSLKTEKQRKKDIHFPIRKYAVKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.55
3 0.48
4 0.53
5 0.5
6 0.49
7 0.48
8 0.53
9 0.5
10 0.47
11 0.46
12 0.38
13 0.33
14 0.28
15 0.25
16 0.16
17 0.15
18 0.17
19 0.17
20 0.17
21 0.16
22 0.16
23 0.16
24 0.16
25 0.15
26 0.12
27 0.11
28 0.13
29 0.14
30 0.14
31 0.15
32 0.14
33 0.19
34 0.23
35 0.32
36 0.32
37 0.36
38 0.39
39 0.39
40 0.43
41 0.41
42 0.39
43 0.31
44 0.27
45 0.23
46 0.26
47 0.3
48 0.28
49 0.3
50 0.31
51 0.32
52 0.37
53 0.41
54 0.39
55 0.39
56 0.43
57 0.44
58 0.48
59 0.52
60 0.55
61 0.6
62 0.61
63 0.57
64 0.58
65 0.55
66 0.54
67 0.56
68 0.57
69 0.58
70 0.61
71 0.7
72 0.66
73 0.66
74 0.63
75 0.65
76 0.66
77 0.66
78 0.69
79 0.69
80 0.75
81 0.81
82 0.86
83 0.87
84 0.86
85 0.86
86 0.86
87 0.82
88 0.8
89 0.82
90 0.81
91 0.82
92 0.84
93 0.82
94 0.82
95 0.85
96 0.86
97 0.83
98 0.83
99 0.83
100 0.84
101 0.84
102 0.79
103 0.79
104 0.8