Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3MUT9

Protein Details
Accession A0A5C3MUT9   
Localization Confidence Low
Confidence Score 5.7
NoLS Segment(s)
PositionSequenceProtein Nature
85-105GTERRLTWRKQAQHRTKGSKGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, cyto 5, cysk 4, nucl 2, plas 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR002125  CMP_dCMP_dom  
IPR016193  Cytidine_deaminase-like  
Gene Ontology GO:0003824  F:catalytic activity  
GO:0006139  P:nucleobase-containing compound metabolic process  
Pfam View protein in Pfam  
PF00383  dCMP_cyt_deam_1  
Amino Acid Sequences MSKAQFYLSQCAEAAAKSPMCFTLGAVMVKGGKIISTGYNHHRTHYDGAEAETRGHRKPVSMHAEMHAIFNFTGMSPSFKTQVQGTERRLTWRKQAQHRTKGSKGSCCSHQHLSGTCFSPQIREGEGPTGEAIFAEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.16
3 0.17
4 0.15
5 0.16
6 0.15
7 0.16
8 0.16
9 0.14
10 0.14
11 0.16
12 0.16
13 0.15
14 0.16
15 0.15
16 0.15
17 0.15
18 0.09
19 0.06
20 0.06
21 0.07
22 0.09
23 0.11
24 0.16
25 0.22
26 0.31
27 0.32
28 0.33
29 0.33
30 0.33
31 0.35
32 0.32
33 0.27
34 0.19
35 0.21
36 0.22
37 0.21
38 0.2
39 0.19
40 0.2
41 0.18
42 0.2
43 0.18
44 0.16
45 0.19
46 0.26
47 0.3
48 0.29
49 0.3
50 0.28
51 0.31
52 0.3
53 0.28
54 0.19
55 0.13
56 0.1
57 0.09
58 0.08
59 0.05
60 0.06
61 0.05
62 0.08
63 0.08
64 0.09
65 0.11
66 0.11
67 0.12
68 0.12
69 0.19
70 0.22
71 0.28
72 0.31
73 0.35
74 0.36
75 0.42
76 0.45
77 0.41
78 0.45
79 0.47
80 0.51
81 0.56
82 0.66
83 0.69
84 0.75
85 0.82
86 0.81
87 0.78
88 0.78
89 0.73
90 0.7
91 0.64
92 0.59
93 0.58
94 0.55
95 0.56
96 0.52
97 0.51
98 0.46
99 0.46
100 0.45
101 0.42
102 0.38
103 0.34
104 0.31
105 0.28
106 0.27
107 0.25
108 0.24
109 0.23
110 0.22
111 0.23
112 0.26
113 0.26
114 0.24
115 0.22
116 0.2
117 0.16