Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3MRS7

Protein Details
Accession A0A5C3MRS7    Localization Confidence High Confidence Score 18.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MSSRGKRKVEEDQLKSQKKKBasic
104-126SASKKPQEAKPPPKAANKRKVIEHydrophilic
NLS Segment(s)
PositionSequence
16-22SQKKKAK
85-123KPRKLKSKPASKGKPASSSSASKKPQEAKPPPKAANKRK
Subcellular Location(s) nucl 25.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR019098  Histone_chaperone_domain_CHZ  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF09649  CHZ  
Amino Acid Sequences MSSRGKRKVEEDQLKSQKKKAKREEEEASAGSEDEDSGVEQDELEALDTSNIITGGRRTRGIRIDYTKVPDAIKDDEEEDEEEVKPRKLKSKPASKGKPASSSSASKKPQEAKPPPKAANKRKVIEEQEDEEEEAGEDEKEEDEASESEEDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.78
3 0.75
4 0.72
5 0.7
6 0.74
7 0.74
8 0.75
9 0.73
10 0.79
11 0.79
12 0.77
13 0.73
14 0.63
15 0.53
16 0.42
17 0.34
18 0.25
19 0.18
20 0.12
21 0.07
22 0.07
23 0.05
24 0.05
25 0.06
26 0.06
27 0.05
28 0.05
29 0.05
30 0.05
31 0.06
32 0.05
33 0.05
34 0.05
35 0.05
36 0.05
37 0.05
38 0.05
39 0.04
40 0.04
41 0.07
42 0.11
43 0.13
44 0.16
45 0.17
46 0.21
47 0.27
48 0.29
49 0.32
50 0.33
51 0.36
52 0.36
53 0.39
54 0.36
55 0.32
56 0.29
57 0.24
58 0.21
59 0.19
60 0.17
61 0.13
62 0.13
63 0.12
64 0.12
65 0.12
66 0.1
67 0.09
68 0.09
69 0.11
70 0.11
71 0.12
72 0.14
73 0.15
74 0.23
75 0.25
76 0.35
77 0.42
78 0.52
79 0.6
80 0.68
81 0.74
82 0.74
83 0.78
84 0.72
85 0.7
86 0.61
87 0.57
88 0.5
89 0.49
90 0.47
91 0.48
92 0.48
93 0.43
94 0.47
95 0.5
96 0.52
97 0.56
98 0.61
99 0.62
100 0.69
101 0.75
102 0.75
103 0.78
104 0.82
105 0.82
106 0.81
107 0.8
108 0.74
109 0.71
110 0.73
111 0.69
112 0.66
113 0.61
114 0.55
115 0.5
116 0.48
117 0.42
118 0.34
119 0.29
120 0.21
121 0.16
122 0.12
123 0.08
124 0.07
125 0.07
126 0.07
127 0.07
128 0.07
129 0.07
130 0.09
131 0.1
132 0.12