Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C3NG94

Protein Details
Accession A0A5C3NG94    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
2-29ASNTEKKPATEKRPKKKSSGGSKKKLSAHydrophilic
NLS Segment(s)
PositionSequence
7-26KKPATEKRPKKKSSGGSKKK
Subcellular Location(s) nucl 18.5, mito_nucl 13.166, cyto_nucl 11.333, mito 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036910  HMG_box_dom_sf  
IPR006780  YABBY  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF04690  YABBY  
Amino Acid Sequences MASNTEKKPATEKRPKKKSSGGSKKKLSAFNKFMQTEMARLKEEEPDMPHQERFKTATSNWSANKNKGKADK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.82
3 0.81
4 0.8
5 0.8
6 0.8
7 0.81
8 0.8
9 0.79
10 0.81
11 0.8
12 0.77
13 0.75
14 0.68
15 0.66
16 0.61
17 0.57
18 0.58
19 0.52
20 0.46
21 0.41
22 0.36
23 0.3
24 0.27
25 0.24
26 0.17
27 0.17
28 0.18
29 0.18
30 0.18
31 0.17
32 0.18
33 0.21
34 0.26
35 0.27
36 0.3
37 0.29
38 0.29
39 0.3
40 0.29
41 0.26
42 0.26
43 0.25
44 0.31
45 0.34
46 0.4
47 0.4
48 0.47
49 0.49
50 0.53
51 0.62
52 0.57