Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3NMJ0

Protein Details
Accession A0A5C3NMJ0   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
92-111GMTMVKEKREKERKAKLRMABasic
NLS Segment(s)
PositionSequence
98-110EKREKERKAKLRM
Subcellular Location(s) mito 14, plas 6, extr 3, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR009914  DPM2  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0030234  F:enzyme regulator activity  
GO:0019348  P:dolichol metabolic process  
GO:0006486  P:protein glycosylation  
Pfam View protein in Pfam  
PF07297  DPM2  
Amino Acid Sequences MVAVPHHSITPATTSPHIHSSKAMGASDRALGGAMLLAASVVFTYYTCWALLLPFLDTSNPVHDFFPSREWAVRIPAFLLVSGLSAIGSFIGMTMVKEKREKERKAKLRMA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.25
3 0.33
4 0.34
5 0.29
6 0.29
7 0.29
8 0.31
9 0.31
10 0.28
11 0.21
12 0.2
13 0.21
14 0.2
15 0.17
16 0.12
17 0.09
18 0.08
19 0.07
20 0.06
21 0.04
22 0.03
23 0.03
24 0.02
25 0.02
26 0.02
27 0.02
28 0.02
29 0.02
30 0.02
31 0.04
32 0.05
33 0.06
34 0.06
35 0.07
36 0.06
37 0.07
38 0.07
39 0.07
40 0.06
41 0.06
42 0.06
43 0.06
44 0.07
45 0.07
46 0.1
47 0.11
48 0.11
49 0.11
50 0.12
51 0.15
52 0.15
53 0.17
54 0.16
55 0.16
56 0.16
57 0.17
58 0.18
59 0.21
60 0.21
61 0.18
62 0.16
63 0.17
64 0.15
65 0.14
66 0.13
67 0.08
68 0.07
69 0.07
70 0.06
71 0.04
72 0.04
73 0.04
74 0.03
75 0.03
76 0.03
77 0.03
78 0.04
79 0.04
80 0.05
81 0.11
82 0.14
83 0.17
84 0.22
85 0.26
86 0.36
87 0.46
88 0.55
89 0.6
90 0.69
91 0.75