Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3MWG7

Protein Details
Accession A0A5C3MWG7   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
2-34VNIPKTRRTYCKGKACKKHTPHKVTQYKKGKDSHydrophilic
NLS Segment(s)
PositionSequence
39-65GKRRYDRKQTGYGGQKKPVFHKKAKTT
Subcellular Location(s) nucl 14, cyto 7, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0016020  C:membrane  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MVNIPKTRRTYCKGKACKKHTPHKVTQYKKGKDSLVAQGKRRYDRKQTGYGGQKKPVFHKKAKTTKKVVLRLECTVCKYKMQLSLKRCKHFELGGEKKTKGAALTFYLLFPPHICLSLLHHVFTAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.83
3 0.84
4 0.87
5 0.87
6 0.87
7 0.87
8 0.85
9 0.84
10 0.85
11 0.87
12 0.83
13 0.85
14 0.85
15 0.8
16 0.76
17 0.71
18 0.62
19 0.56
20 0.53
21 0.53
22 0.52
23 0.51
24 0.51
25 0.52
26 0.55
27 0.58
28 0.59
29 0.55
30 0.55
31 0.6
32 0.61
33 0.64
34 0.62
35 0.62
36 0.67
37 0.7
38 0.63
39 0.6
40 0.57
41 0.5
42 0.55
43 0.56
44 0.52
45 0.48
46 0.53
47 0.57
48 0.64
49 0.72
50 0.71
51 0.68
52 0.68
53 0.71
54 0.7
55 0.66
56 0.62
57 0.57
58 0.54
59 0.51
60 0.46
61 0.41
62 0.38
63 0.33
64 0.28
65 0.25
66 0.25
67 0.3
68 0.36
69 0.4
70 0.43
71 0.53
72 0.6
73 0.64
74 0.62
75 0.56
76 0.52
77 0.47
78 0.47
79 0.47
80 0.47
81 0.48
82 0.51
83 0.48
84 0.45
85 0.44
86 0.38
87 0.28
88 0.22
89 0.18
90 0.17
91 0.2
92 0.19
93 0.19
94 0.19
95 0.18
96 0.17
97 0.15
98 0.16
99 0.14
100 0.14
101 0.15
102 0.15
103 0.21
104 0.3
105 0.31
106 0.27