Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C3N8I6

Protein Details
Accession A0A5C3N8I6    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MGRSAKLHKRVDRKKTKSTTSVHydrophilic
NLS Segment(s)
PositionSequence
9-15KRVDRKK
Subcellular Location(s) mito 15, nucl 7, cyto 5
Family & Domain DBs
Amino Acid Sequences MGRSAKLHKRVDRKKTKSTTSVLPAAKPELAAAVASSRKKANLKDKVGKRTTSEGHVLGGADYVDIMMGGRRKAKAEAAKLPQDDDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.85
3 0.84
4 0.8
5 0.74
6 0.7
7 0.65
8 0.65
9 0.56
10 0.48
11 0.42
12 0.37
13 0.33
14 0.25
15 0.19
16 0.11
17 0.1
18 0.09
19 0.07
20 0.07
21 0.11
22 0.11
23 0.13
24 0.12
25 0.15
26 0.19
27 0.25
28 0.32
29 0.38
30 0.46
31 0.53
32 0.6
33 0.66
34 0.67
35 0.62
36 0.55
37 0.51
38 0.46
39 0.4
40 0.36
41 0.27
42 0.24
43 0.23
44 0.2
45 0.14
46 0.12
47 0.09
48 0.05
49 0.05
50 0.04
51 0.03
52 0.03
53 0.03
54 0.05
55 0.07
56 0.09
57 0.13
58 0.15
59 0.17
60 0.2
61 0.28
62 0.33
63 0.39
64 0.46
65 0.5
66 0.57
67 0.56