Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C3N3N3

Protein Details
Accession A0A5C3N3N3    Localization Confidence Low Confidence Score 6.5
NoLS Segment(s)
PositionSequenceProtein Nature
78-100LKSEHRGQKCRPRLRLRLRDTMYHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 18, nucl 4, mito 2, cyto_nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR003807  DUF202  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF02656  DUF202  
Amino Acid Sequences MPNASARDQLHAQKHPSLHISWEPRDTEESSRDMDSARSPDQAEDQRQQSPCSGAVSTVAQPSPSGGDGTPTTAIESLKSEHRGQKCRPRLRLRLRDTMYNPGLELINSGSVARDHLANERTILAYVRTSLALSSMGVALVQLFTLSNSASGTKSALHVYARPLGATGVVLGLLVLLIGVVRYFTVQTALTRGNFPVARVTVIVVGLVLTALICVMFGVLVASRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.47
3 0.46
4 0.4
5 0.37
6 0.39
7 0.42
8 0.4
9 0.44
10 0.41
11 0.4
12 0.43
13 0.4
14 0.37
15 0.33
16 0.31
17 0.28
18 0.28
19 0.26
20 0.23
21 0.21
22 0.21
23 0.23
24 0.22
25 0.22
26 0.22
27 0.22
28 0.29
29 0.33
30 0.35
31 0.36
32 0.37
33 0.41
34 0.41
35 0.42
36 0.37
37 0.32
38 0.28
39 0.25
40 0.22
41 0.15
42 0.16
43 0.17
44 0.16
45 0.17
46 0.15
47 0.13
48 0.13
49 0.13
50 0.13
51 0.11
52 0.1
53 0.08
54 0.1
55 0.1
56 0.13
57 0.13
58 0.11
59 0.11
60 0.11
61 0.12
62 0.1
63 0.11
64 0.11
65 0.14
66 0.17
67 0.2
68 0.26
69 0.33
70 0.39
71 0.45
72 0.54
73 0.6
74 0.65
75 0.71
76 0.74
77 0.78
78 0.81
79 0.85
80 0.81
81 0.8
82 0.73
83 0.71
84 0.64
85 0.61
86 0.52
87 0.41
88 0.34
89 0.25
90 0.23
91 0.16
92 0.14
93 0.06
94 0.06
95 0.05
96 0.05
97 0.05
98 0.05
99 0.05
100 0.05
101 0.05
102 0.06
103 0.09
104 0.11
105 0.11
106 0.11
107 0.12
108 0.11
109 0.11
110 0.11
111 0.08
112 0.07
113 0.07
114 0.07
115 0.07
116 0.07
117 0.06
118 0.06
119 0.06
120 0.06
121 0.06
122 0.05
123 0.05
124 0.04
125 0.04
126 0.04
127 0.03
128 0.03
129 0.03
130 0.03
131 0.03
132 0.04
133 0.04
134 0.04
135 0.05
136 0.06
137 0.06
138 0.07
139 0.07
140 0.08
141 0.09
142 0.1
143 0.11
144 0.11
145 0.12
146 0.15
147 0.19
148 0.19
149 0.17
150 0.17
151 0.15
152 0.14
153 0.12
154 0.09
155 0.05
156 0.04
157 0.04
158 0.03
159 0.03
160 0.03
161 0.02
162 0.02
163 0.02
164 0.02
165 0.02
166 0.02
167 0.02
168 0.02
169 0.03
170 0.04
171 0.04
172 0.07
173 0.08
174 0.09
175 0.13
176 0.16
177 0.17
178 0.18
179 0.19
180 0.23
181 0.23
182 0.23
183 0.25
184 0.23
185 0.23
186 0.22
187 0.22
188 0.17
189 0.17
190 0.16
191 0.09
192 0.08
193 0.06
194 0.06
195 0.04
196 0.03
197 0.03
198 0.03
199 0.02
200 0.02
201 0.02
202 0.03
203 0.02
204 0.03
205 0.04